KEGG   Petrimonas mucosa: ING2E5A_1164Help
Entry
ING2E5A_1164      CDS       T04553                                 

Gene name
fucA1
Definition
(GenBank) L-fuculose phosphate aldolase {ECO:0000255|HAMAP-Rule:MF_00987}
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
pmuc  Petrimonas mucosa
Pathway
pmuc00051  Fructose and mannose metabolism
pmuc01100  Metabolic pathways
pmuc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pmuc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    ING2E5A_1164 (fucA1)
Enzymes [BR:pmuc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     ING2E5A_1164 (fucA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II Tab2_like
Motif
Other DBs
NCBI-ProteinID: SCM57055
UniProt: A0A1G4G671
Position
I:1404373..1405671
Genome map
AA seq 432 aa AA seqDB search
MKQLDVQLMHPVEQINIIIGRIYRSGMTTTSGGNISIRDDNGDIWITPSGVDKGNLTTKD
IMLVKRDGSIIGPHRPSSEYPFHRAIYEARPDIRAIIHAHPPALVAFSIAGTVPDTKIVP
QAHNVCGEIGFAPYGTPGSEDLGEKIAKVFQDKRYRAVIMENHGVVLGGSDMMDAYQRFE
TLEFCCRTIVNAGKLGKVNYLTDQQVNSYVNHIPKNIAHFMDVDYPSDERALRTEMVNII
RRACDQGLMISTYGTVSVRWRNDDFLITPRDVARWDIMPSDIVQIRNGMAEAGKTPSRSV
ALHQRIYQLNPHINSIICTQPINLMAHAVSGTKFDVRTIPESWIFLQDVPSIPFGLIYHE
IEDVAKMFKKNRVIMVENDGVFVTGDKLLTTFDYLEVAEFSANSLVMASAIGPLKPIGDK
EIDDLRIAFNVG
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagttggacgttcaattaatgcatccggtagagcagatcaacatcattatcgga
agaatctatcgaagcggaatgaccaccacttccggtggaaacatctcaatccgtgacgat
aatggtgatatctggatcacgccgtcgggtgtagacaagggaaaccttaccacaaaggac
atcatgctcgtaaagagggatggctccataatcggtccccacagaccctcttccgagtat
cctttccaccgggctatctacgaggcccgtcccgacatcagagccatcatacatgcgcat
ccgcccgcactggttgctttcagcatcgccggaacggttcccgacaccaagattgttcct
caagcccacaacgtgtgcggtgagatcggttttgccccatacggcacacccggaagtgag
gatcttggggaaaagatcgccaaggtgtttcaagataagcgttatcgggcagtgattatg
gagaatcacggcgttgtgctgggcgggtcggacatgatggatgcctaccagcggttcgag
accctggagttttgctgccgcaccattgtaaatgccggaaaactcggaaaggtgaactat
ctgaccgatcagcaggtcaacagctatgtgaaccatatccccaagaacatcgctcatttc
atggatgtggattatccctccgacgagcgcgcactgcgtaccgagatggtcaacatcatc
cgtcgcgcctgcgatcagggattgatgatatctacctacggaacggttagtgtccgctgg
cgcaacgacgacttcctgatcacgccgcgcgacgtggcccgttgggatatcatgcccagc
gacatcgtgcagatacgaaacggcatggccgaagcagggaagactcccagccgctcagtg
gcgcttcaccaacggatctatcagctcaacccgcacatcaactccattatctgtactcaa
ccgatcaacctgatggcacatgccgttagcgggaccaaattcgacgtgcggacgatcccc
gaaagctggatcttcctgcaggatgttccctccatcccgttcgggttgatctaccacgag
attgaagatgtggcgaagatgttcaagaagaaccgggtgatcatggtagagaatgatggc
gtttttgtaacgggagacaagttgctcaccactttcgattacctggaggttgccgagttc
tcggccaactcgcttgtcatggcgtctgctatcggtccgttgaagccaataggagacaag
gagattgatgatcttcgaattgcctttaacgttggatag

DBGET integrated database retrieval system