KEGG   Petrimonas mucosa: ING2E5A_2950Help
Entry
ING2E5A_2950      CDS       T04553                                 

Gene name
gcvT
Definition
(GenBank) Aminomethyltransferase {ECO:0000255|HAMAP-Rule:MF_00259}
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
pmuc  Petrimonas mucosa
Pathway
pmuc00260  Glycine, serine and threonine metabolism
pmuc00630  Glyoxylate and dicarboxylate metabolism
pmuc00670  One carbon pool by folate
pmuc01100  Metabolic pathways
pmuc01110  Biosynthesis of secondary metabolites
pmuc01130  Biosynthesis of antibiotics
pmuc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmuc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ING2E5A_2950 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ING2E5A_2950 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    ING2E5A_2950 (gcvT)
Enzymes [BR:pmuc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     ING2E5A_2950 (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C SoxG
Motif
Other DBs
NCBI-ProteinID: SCM59744
UniProt: A0A1G4GB32
Position
I:3552705..3553790
Genome map
AA seq 361 aa AA seqDB search
MKTTAFTDIHIALGAKMHEFAGYNMPIEYSGIIDEHMTVVNGVGVFDVSHMGEFWVKGPK
ALEFIQKVTSNDASKLPVGKVQYTCFPNELGGIKDDLLLYRYGPEKYMLVVNAANIEKDW
EWCLKQNSMGAVIEDASAHTALLALQGPKAKATLQKLTDTDLDSIPYYAFTTGKVAGVEQ
VIISNTGYTGAGGFELYFYPEEGIRIWNALFEAGAEFGIKPIGLGARDTLRLEMGFCLYG
NDLDETTTPLEAGLGWITKLTDGNNFVGREIIEKQKSDGVTRKLCGFTLLEKGIPRHGYE
IVNMDEEPIGVVTSGTISPVLKTGIGLGYVKPEFAKAGTVIGIRVRNKSLKAEVTQLPFR
K
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgacagcttttacagatatacacatcgcactgggtgcaaaaatgcacgagttt
gcaggttacaacatgcccatcgaatattcgggcattatcgacgaacatatgacggtggtg
aacggcgtgggggtgttcgacgtttcacatatgggcgaattttgggtaaagggacccaag
gcgctggagtttatccagaaagtgacctccaacgacgcatcgaaactaccggtgggaaag
gttcagtacacctgctttcctaacgagctggggggcataaaggatgacctgctgctctac
cgttacggaccggagaaatatatgctggtggtcaacgccgccaatatcgagaaggattgg
gagtggtgcctgaaacagaacagcatgggtgcggttatcgaggacgcttctgcccacacc
gcactgcttgccctgcagggacccaaggcgaaagccacgctgcaaaaactgaccgacacc
gacctcgactcgatcccctactacgcatttactaccgggaaggtagccggcgtggagcag
gtgatcatctccaataccggctataccggtgccggcggattcgaactctatttctatccc
gaagaggggatcaggatctggaacgccctctttgaagccggggcggagttcggcatcaag
ccaataggtctgggggcccgcgacaccctgcggctcgagatgggcttctgtctctacgga
aacgacctcgacgagaccaccacccccctagaggcaggattgggctggattaccaaactg
accgacggaaacaacttcgtgggaagggagatcatcgagaagcagaaatcggatggggta
acccgaaaactgtgcggtttcacactgctggagaaagggattccacgtcacggttacgag
attgtcaacatggatgaggagcccatcggcgtggtcacctccggaacgatctctcccgtg
ttaaagactgggattggcctgggatacgtgaagcccgaatttgcaaaggcgggaaccgtc
atcggcatcagggtacgcaacaagagcctgaaagcggaagttacccagctgccgttcaga
aaataa

DBGET integrated database retrieval system