KEGG   Pasteurella multocida ATCC 43137: DR93_1715Help
Entry
DR93_1715         CDS       T03322                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
pmul  Pasteurella multocida ATCC 43137
Pathway
pmul00520  Amino sugar and nucleotide sugar metabolism
pmul01100  Metabolic pathways
pmul01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pmul00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    DR93_1715 (nagA)
Enzymes [BR:pmul01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     DR93_1715 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: AIN48484
UniProt: A0A1E3XI56
Position
complement(1790972..1792108)
Genome map
AA seq 378 aa AA seqDB search
MYAFVNAVIYTAKDVLYGKALVVDGDKISAILPVEDVPENLQKIDLQGNNLTAGFIDLQL
NGCGGVMFNEDISVKTLEIMQETNLKSGTTSYLPTFITSPDEGMKDAVKVMREYLTQYKN
QALGLHFEGPYLSVEKKGVHREEYIRAISPEMKTFLCDNADVITKITLAAENPTAQYIPD
FVEKGIIVSLGHSNATYDVAQQAIEKGASFATHLHNAMSPISSGRAMGVVGAVLDSDIYT
GIIVDGLHVDYGNIRLDKKVKGDKLCIVTDATAAAGADIDSFVFVGKTVYVRDGKCYDSN
GTLGGAAITMIESVKNAVQEVGIPLDETLRMCNYYPAKAIGVDHKLGSIEVGKIANLTAF
TNDFNVLGTAVNGEWKAN
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgtacgcgtttgttaatgccgtaatttacactgcaaaagacgtactttatggtaaagcg
cttgttgtcgatggcgataaaattagtgcaattctacccgtagaagacgtgccagaaaat
cttcagaaaattgatttacaagggaataatttaaccgcaggttttattgatcttcaatta
aatggctgtggtggcgtgatgtttaatgaagatattagcgtgaagacgttagagatcatg
caagaaactaatttgaaatccggcacgacaagttatttaccaacctttattacgtcacct
gatgaaggaatgaaagacgcagtgaaggtgatgcgtgagtatttaactcagtataaaaat
caagcattaggtttacactttgaaggaccttatttgagtgttgagaaaaaaggagtacat
cgcgaagaatatattcgtgcgataagcccagaaatgaaaacattcttgtgtgataatgca
gatgtgattactaaaatcacgttggcagccgaaaatccaacggcacagtatattccagac
tttgttgaaaaagggattatcgtctcgcttggacactcgaatgcgacttacgatgtcgca
caacaggctattgagaaaggggcgagttttgcaacccatttacataatgcaatgtcacca
atcagctctggacgagcgatgggagtagtgggcgccgtattagattctgatatctataca
ggtattattgtggatggtttacacgttgattatggcaatatacgactcgacaagaaagta
aaaggtgacaaattgtgcattgtgacagatgcaactgctgcagccggtgcagacattgac
tcctttgttttcgtcggtaaaaccgtctatgtgcgtgatggtaaatgctatgatagcaat
ggtacattaggtggcgctgcaatcacgatgattgagtcagtgaaaaatgcggtacaggaa
gttggcattccattggatgagacattgcgtatgtgtaattactatcctgctaaagcaatt
ggtgtggaccataaacttggctcaattgaagtgggtaaaatcgcgaatttaacagcattc
acaaatgattttaacgtgttgggtacagccgtgaatggtgaatggaaagcgaattaa

DBGET integrated database retrieval system