KEGG   Pasteurella multocida ATCC 43137: DR93_903Help
Entry
DR93_903          CDS       T03322                                 

Definition
(GenBank) mannitol dehydrogenase Rossmann domain protein
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
pmul  Pasteurella multocida ATCC 43137
Pathway
pmul00051  Fructose and mannose metabolism
pmul01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmul00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    DR93_903
Enzymes [BR:pmul01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     DR93_903
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UDPG_MGDP_dh_N Sacchrp_dh_NADP GerD
Motif
Other DBs
NCBI-ProteinID: AIN49351
Position
complement(907611..908768)
Genome map
AA seq 385 aa AA seqDB search
MKALHFGAGNIGRGFIGKLLADSGIQVIFADVNDHVIEQLKTQRAYPVKIVGDRLNVIET
VSNVTGVNSKNEADIIACFTEVDLVTTAVGPNVLKIISSTIAKGLSARFRAGNTRPLNII
ACENMVRGTSFLKDNVFSYLTPEEQQQAEAQIGFVDSAVDRIVPPVQFDPANPLLVTVEE
FSEWIVDKTQFKGTIPAINGMEQTDNLMAFVERKLFTLNTGHATTAYLGKLKGHQFVKDS
IDDPDIREAVKATMQESGAVLIKRYGFDPHAHAAYIEKILKRFANPYLQDDVDRVGREPL
RKLSYNDRLIKPLRGTLEYGLPNQHLIQTIASALAYRNESDPQAVELAQLLQQDALESAV
KKITELTESNIVQQIVTAYNALQKN
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattacattttggtgcgggtaatattggacgtggatttatcggaaaattatta
gctgatagtggtattcaagtcatctttgccgatgtcaatgatcatgttattgagcaactc
aaaacacaacgggcttatccagtcaaaattgttggcgatcgcctgaatgtaattgaaacc
gtgtcaaacgtcacaggagtcaattctaaaaatgaggcggatattattgcatgctttact
gaagttgatttagtgaccaccgcggtgggacctaatgtattaaaaatcatttcaagcact
attgcaaaaggcttaagcgcacgttttcgtgcaggaaatacccgcccattaaatattatt
gcatgtgaaaatatggtgcgaggtaccagctttttaaaagacaatgtgttctcttatctc
acccctgaagaacagcaacaagcggaagcacagattggctttgttgattctgccgttgat
cgcatcgtgccaccagtacagtttgatcccgccaacccgttattagtgacagttgaagag
ttcagtgaatggattgtagataaaacccaatttaaaggtacaattccagctattaatggt
atggagcaaacggataatttaatggcatttgttgagcgtaaactgtttacattaaatact
ggacacgccacgaccgcctatttaggcaaattaaaaggtcaccaatttgtcaaagacagc
attgatgatccagacatcagggaagccgttaaagccacgatgcaagaaagtggtgccgta
ttaattaaacgttatggttttgatcctcatgcccacgcggcttacattgaaaaaatcctg
aagcgttttgccaatccgtatttacaagatgatgttgatcgtgtgggcagagaaccttta
cgaaaactcagctataacgatcgtttaatcaaaccattacgtggcaccttagaatatgga
ttaccaaatcaacatttaattcaaaccattgctagtgccttagcctatcgcaatgagagt
gatccacaagcagttgaattagctcaacttttacagcaagatgcgctcgaaagtgcggtg
aaaaaaatcactgaactgacagaatcaaacattgtgcaacaaatcgtaactgcttataat
gccttgcaaaaaaactaa

DBGET integrated database retrieval system