KEGG   Prunus mume (Japanese apricot): 103321907Help
Entry
103321907         CDS       T03196                                 

Definition
(RefSeq) L-tryptophan--pyruvate aminotransferase 1-like
  KO
K16903  L-tryptophan---pyruvate aminotransferase [EC:2.6.1.99]
Organism
pmum  Prunus mume (Japanese apricot)
Pathway
pmum00380  Tryptophan metabolism
pmum01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmum00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    103321907
Enzymes [BR:pmum01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.99  L-tryptophan---pyruvate aminotransferase
     103321907
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alliinase_C Aminotran_1_2 DUF4903 Complex1_51K
Motif
Other DBs
NCBI-GeneID: 103321907
NCBI-ProteinID: XP_008221983
Position
LG2
AA seq 404 aa AA seqDB search
MCGTDSPASINKGSLTSANGNGTRSPTCSSDRVLNLEQGDPSVFQSYWSKMEDKCTMVIS
GSQLMSYISDFTTLCWFMEPEFEEAVRRLHRVVGNAVVDDRYIVVGTGSTQLYQAALYAL
TSPGGPEPVSVVSAAPYYSAYPEETDYLRSRLYKWAGDAYEFDKNGTGPYIEVVNSPNNP
DGTLREAVVKNRGDEGKLIHDLAYYWPQYTPIIRPADHDIMTFTFSKSTGHAGSRIGWAI
VKDKEVARKMSKFIEMSTLGVSKDSQQRAAKIMGVICDGYKNFKSDELFFEHTRRVMAER
WERLRQVVDRNQVFSLPKYPKQYCLFSGELIEPYPGFAWLEAKEEEEEIDSQKVLRGCIK
VQGRTGSRFGVAQKYVRVSLLSNEEVFNQFLERLSTIKSISNGH
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcacagacagccctgcttccattaacaaaggctctttgacctctgccaatggc
aatggcaccagaagccctacttgctcatctgaccgtgtcctcaatcttgaacagggtgac
ccatcagtgttccaatcatactggagcaagatggaggacaagtgtacgatggtgatctct
gggagccaattgatgagctatatcagcgatttcaccaccctctgctggtttatggagcca
gaatttgaggaggcagttaggaggcttcatcgtgtcgttggaaatgcagtggtggatgat
cggtatattgtagtggggacaggctccacccagctttatcaggctgcgttgtatgctctc
acttcccctggtggtcctgagcccgtcagcgttgtgtctgctgccccttactactcggca
tatccagaggagacggactacctccgttcacggctatacaaatgggcaggtgatgcttat
gagtttgataagaatggaactggaccttacattgaggttgtcaactccccaaataacccc
gacggcactctccgggaggccgtcgtgaaaaacagaggtgatgaagggaagctcattcat
gaccttgcctactactggccacagtacacacccattattcgtccggctgatcatgacatt
atgaccttcacattttccaaaagcacagggcatgctgggtcacgcattggatgggctatt
gttaaggacaaagaagttgctagaaagatgtctaaattcatagagatgagtacacttggc
gtgtccaaagattcccagcaacgagctgcaaagataatgggagtgatttgtgatggctat
aagaacttcaaatctgatgagctcttttttgagcacacccgccgagtcatggctgagaga
tgggagaggctgaggcaagtggttgatcgcaatcaagttttcagtctgcccaagtacccc
aaacagtactgccttttctctggagagttgattgaaccatatccaggatttgcatggttg
gaggccaaggaggaggaggaggagatagactcacagaaggttttacgaggatgcataaag
gtacagggaagaacagggagccgctttggggttgctcagaagtatgttagggtcagcttg
ctcagcaatgaagaggtgtttaaccagttcttggagagattatcaactattaaatctatc
agcaatggccattaa

DBGET integrated database retrieval system