KEGG   Prunus mume (Japanese apricot): 103322503Help
Entry
103322503         CDS       T03196                                 

Definition
(RefSeq) uncharacterized protein LOC103322503
  KO
K17434  large subunit ribosomal protein L53
Organism
pmum  Prunus mume (Japanese apricot)
Brite
KEGG Orthology (KO) [BR:pmum00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:pmum03011]
    103322503
Ribosome [BR:pmum03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    103322503
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MRP_L53 L51_S25_CI-B8 DUF3731
Motif
Other DBs
NCBI-GeneID: 103322503
NCBI-ProteinID: XP_008222652
Position
LG2
AA seq 128 aa AA seqDB search
MLKFLSRVRIEFNALDPRTASCLEFLAQCNARKAKESNPSCAVQVKRRTDDEPPKITVTF
VNGVEEVFNATATPAQDIRNMILEKGQSLETEQMFRDAGEPWPVVIPAEELHQPAPGTKP
RKAEEKKQ
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagttcctgtcaagggtgaggattgagttcaatgccttggacccacgtacggcc
tcgtgtcttgagttcttggcacagtgcaatgcccggaaggccaaggagtccaacccctcc
tgcgctgtccaagtcaagcgccgaactgatgatgagccgcccaagatcaccgtcaccttc
gtcaacggagttgaggaggtgttcaatgccaccgccactcccgcccaggacatcaggaac
atgattcttgaaaagggtcagagcctcgagactgagcagatgttccgcgacgctggtgag
ccttggcctgttgttattcccgccgaggagctccaccaaccggcccctggtaccaagccg
aggaaagcagaagagaaaaagcagtaa

DBGET integrated database retrieval system