KEGG   Prunus mume (Japanese apricot): 103330905Help
Entry
103330905         CDS       T03196                                 

Definition
(RefSeq) transcription elongation factor TFIIS-like
  KO
K03000  DNA-directed RNA polymerase I subunit RPA12
Organism
pmum  Prunus mume (Japanese apricot)
Pathway
pmum03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:pmum00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    103330905
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:pmum03021]
    103330905
Transcription machinery [BR:pmum03021]
 Eukaryotic type
  RNA polymerase I system
   RNA polymerase I
    Pol I specific subunits
     103330905
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TFIIS_C zinc_ribbon_2 DZR DUF3716 DNA_RNApol_7kD zf-CHC2 DUF4165 Zn-ribbon_8 Baculo_LEF5_C PhnA_Zn_Ribbon Zn_Tnp_IS1595 Ogr_Delta
Motif
Other DBs
NCBI-GeneID: 103330905
NCBI-ProteinID: XP_016649663
Position
LG5
AA seq 111 aa AA seqDB search
MARNMSANQKCSGGFKKMSILSFSNTIFVALFVSPNQGITLYVSLLQDIRRELGISIICE
EKVQLQKTDAKTCEKCGHNEHTYYSRQMRSADEGATTFYACTNCQHQFTEN
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggaacatgagcgccaatcagaagtgctcgggcggtttcaagaagatgtcgatt
ctttctttcagcaacaccatttttgttgcgttgtttgtatcaccaaaccaaggcattact
ctatatgtgtccttgttgcaggatattagaagggagctaggcatatcaataatttgtgaa
gaaaaagtgcaattgcaaaagacagatgctaaaacatgtgaaaaatgtggccacaatgag
catacatattattccagacagatgcgatcagcagatgaaggagcaactactttctacgcg
tgcaccaattgccagcaccagtttactgagaattga

DBGET integrated database retrieval system