KEGG   Prunus mume (Japanese apricot): 103332629Help
Entry
103332629         CDS       T03196                                 

Definition
(RefSeq) methionine--tRNA ligase, chloroplastic/mitochondrial
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pmum  Prunus mume (Japanese apricot)
Pathway
pmum00450  Selenocompound metabolism
pmum00970  Aminoacyl-tRNA biosynthesis
pmum01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmum00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    103332629
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    103332629
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pmum01007]
    103332629
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pmum03016]
    103332629
Enzymes [BR:pmum01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     103332629
Amino acid related enzymes [BR:pmum01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   103332629
Transfer RNA biogenesis [BR:pmum03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    103332629
 Prokaryotic type
   Other AARSs
    103332629
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 FMN_red
Motif
Other DBs
NCBI-GeneID: 103332629
NCBI-ProteinID: XP_008233599
Position
LG5
AA seq 603 aa AA seqDB search
MAAAAARINFFLNPINPLNSKATTHLRTRLHFQPSRRRPRATSFCTRASATPLHDEAAAS
DPFVLTTPLYYVNAPPHLGSAYTTIAADAIARFQRLLGKKVIFITGTDEHGEKIATAAAD
SASTPAQHCDIISQSYISLWKNLDIAYDKFIRTTDPKHEAIVKEFYSRVLANGDIYRADY
EGLYCVNCEEYKDEKELLDNNCCPTHLKPCVARKEDNYFFALSKYQKSLEETLAKNPNFV
QPSFRLNEVQSWIRSGLRDFSISRALVDWGIPVPNDSKQTIYVWFDALLGYISALSEDTE
QPDLERAVSSGWPASLHLIGKDILRFHAVYWPAMLMSAGLGLPKMVFGHGFLTKDGMKMG
KSLGNTIEPNDLVHKFGSDAVRYFFLREVEFGNDGDYSEDRFINIVNAHLANSIGNLLNR
TLGLLKKNCQSTLLVDSSIAAEGITFKDTVEKLVEKARVQYGNLSLSSACEAVLEISNAG
NLYMDGRAPWSLFKQGGAASEAAAKDLVIILEAMRIIAVALSPVTPSLSWRIYGQLSYSK
EQFDAATWSDTKWGGLKSGQVMAQPKPIFARIENPTEEQNGVEAPKKAVMKDKLPQAKRV
VEA
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagcagcagcgagaataaacttcttcttaaaccccataaatcccctcaactcc
aaagccaccacccatctcaggacccgcctccactttcagccatcaagaagaagacccaga
gctacgtcgttttgcacgcgtgcctcggctactcccctccacgacgaagccgccgccagt
gacccttttgtcctcaccactccactttattacgtgaatgcccctcctcatttgggcagc
gcttacaccaccatcgctgccgatgccattgctcgctttcagaggctgttgggtaagaag
gtcatcttcatcactggcactgatgagcatggtgaaaagattgccactgcagctgctgat
agtgcctccacaccagctcaacactgtgacatcatttcacagtcttacatatcactctgg
aaaaacttagatatagcttacgacaaattcattcgaacaactgatcccaagcatgaagca
attgtgaaggagttttactcaagggttcttgccaatggagacatttacagggctgactat
gagggactttattgtgtcaattgtgaggagtataaggatgagaaagaactgcttgataac
aactgttgccctacgcacctaaagccatgtgttgcacggaaagaggataattacttcttt
gcattgtccaagtatcaaaagtcgttggaagaaactttggcaaaaaatccgaattttgta
cagccttcattccgtcttaatgaggttcaaagttggattagaagtggcctaagagacttt
tccatttctcgagcattagtggattggggcatccctgttcctaatgatagcaagcaaaca
atatatgtttggtttgatgctttactgggttatatatcagccctatctgaagatacggag
caacctgatttggaaagagccgtttcatcagggtggcctgcctcgctacacttgattggc
aaggatattttacgtttccatgcagtctactggccagctatgctgatgtctgctggacta
ggccttcctaagatggtgtttggccatggattcttgacaaaggatggcatgaagatgggg
aagtcgctgggcaatacaattgaaccaaatgatttggttcataaattcgggtctgatgcg
gtcaggtacttcttcctcagggaggtggaatttggaaatgacggggactattcagaagat
cgtttcatcaatattgtcaatgctcatcttgccaattcaattggaaatctgcttaaccgt
actctgggacttcttaagaagaactgccaatcaactttgttggttgattcaagtattgca
gctgaaggaattacatttaaggacactgtggagaagttggtggaaaaagctcgggttcag
tatggaaacctctcgctgtcatcagcttgtgaggctgtgctagagatcagcaatgctgga
aatttatacatggatgggcgcgcaccctggtctctttttaagcaagggggtgctgcttct
gaagccgctgcaaaggaccttgtgataatattagaagcaatgaggattatagcagttgca
ttatcacccgtcacgccgagcttatcttggagaatatatggacagcttagctactcaaag
gaacagtttgatgctgctacctggagcgacaccaagtggggtggcctaaagagtggtcag
gtcatggcgcaacctaaaccaatctttgcaaggattgaaaacccaacagaagagcaaaat
ggggttgaagcacctaaaaaggcagtcatgaaggacaagctacctcaagccaaacgggtg
gtggaagcgtaa

DBGET integrated database retrieval system