KEGG   Prunus mume (Japanese apricot): 103332825Help
Entry
103332825         CDS       T03196                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1 isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
pmum  Prunus mume (Japanese apricot)
Pathway
pmum00010  Glycolysis / Gluconeogenesis
pmum00562  Inositol phosphate metabolism
pmum01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmum00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103332825
   00562 Inositol phosphate metabolism
    103332825
Enzymes [BR:pmum01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     103332825
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     103332825
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 103332825
NCBI-ProteinID: XP_008233804
Position
LG5
AA seq 495 aa AA seqDB search
MKRAMAAVLLVLLSLLVHSNAEEEAFDVRQHLSTVSRYGVVKGIADSSFVPSKIPNGCTP
IHLNLVARHGTRSPTKKRIKELDNLATHLEVLLREAEEQNLSLEKLPGWLKGWKSPWKGK
LKGGELTIQGEDELYDLGIRTRARFPNLFNDDYHPDVYAIKATQVPRASASAVAFGMGLF
SGKGSLGPGRHRAFAVTSESRASDTKLRFHDCCQNYKAFKKSQEPAVDKLKEPVYDEITS
ALRRRYRLNFTRQDTTSLWFLCKQEASLLNIVDQGCALFSPSEVSLLEWMDDLEAFILKG
YGKSINYRMGVPLLEDVVQSMEQAIKAEEEKHAPGSYEKARLRFAHAETVIPFSCLLGLF
LDGSEFEKIQREQALPHPPKPPQKRNWRGHTVAPFGGNNMLVLYSCPANTSNKHFVQVLH
NEHPIPMPGCDGTDFCPLDVFKERIVAPHLKHDYNSVCDVKLEQQEQKPVASKLSQLFRW
MFSLGNGEKSSLDEL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgggccatggcggctgttctgctagtgttattatcgctactcgttcattcaaat
gccgaagaagaagctttcgatgttcgccaacacctttctactgtttccagatacggtgtc
gttaaaggcattgcggacagttcatttgttccatcgaagattccaaatggatgtactcct
atccacttaaatcttgtggcaaggcatggaactcgttctcctaccaaaaagcggattaaa
gagttggacaacttggcaactcatctggaggttttactgagagaagctgaagaacagaac
ctgtctttggaaaaacttcctggttggttaaagggttggaagtctccttggaaaggaaaa
ctgaaaggtggagaattaactatccaaggagaggatgaactctatgatcttgggatcagg
actcgagcaagatttccaaatttgtttaatgatgattaccatccagatgtttatgcaata
aaggcaacacaggtccctcgggcatcagccagtgctgtggcatttggcatgggattgttt
agtgggaaaggaagtcttggaccagggcgtcatcgagcttttgctgtaaccagcgaaagc
cgtgcaagtgatacaaagctaaggtttcatgattgttgtcaaaactacaaggcatttaag
aaaagtcaggagcctgctgttgataagcttaaggaacccgtttatgatgaaataacttct
gcattaagaaggcgctacaggttgaattttacaaggcaggatacgacttctctgtggttt
ctgtgcaaacaggaagcgtccttgttgaatatagttgatcaaggttgtgcacttttcagc
ccttctgaggtttctttgctggaatggatggatgatttggaggcctttatattaaaggga
tatggtaaatcaataaactatagaatgggagtgcccttacttgaagatgttgtgcagtcc
atggagcaggctattaaggctgaagaagaaaaacatgctcctggtagttatgagaaggcg
agactacggttcgcacatgcagaaactgtcattccattttcatgcctacttggacttttt
cttgacggatctgaatttgaaaaaatacagagggaacaggccttgccacaccctccaaag
cctccccagaagagaaattggaggggccatactgtggcaccttttggtgggaataacatg
ctggttctgtacagttgtccagccaacacatcaaacaagcactttgtgcaagtgctgcac
aatgaacatcctattccaatgccaggttgtgatggtactgatttctgtccacttgatgtt
tttaaggaaagaattgttgctcctcatttgaagcatgactataattctgtgtgcgatgta
aaactagaacaacaggagcagaagcctgttgctagtaagttatctcaactgttccgttgg
atgttctcactggggaatggtgagaaaagttccctcgatgaattgtag

DBGET integrated database retrieval system