KEGG   Prunus mume (Japanese apricot): 103333208Help
Entry
103333208         CDS       T03196                                 

Definition
(RefSeq) tripeptidyl-peptidase 2
  KO
K01280  tripeptidyl-peptidase II [EC:3.4.14.10]
Organism
pmum  Prunus mume (Japanese apricot)
Brite
KEGG Orthology (KO) [BR:pmum00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pmum01002]
    103333208
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pmum03110]
    103333208
Enzymes [BR:pmum01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.10  tripeptidyl-peptidase II
     103333208
Peptidases and inhibitors [BR:pmum01002]
 Serine peptidases
  Family S8: subtilisin family
   103333208
Chaperones and folding catalysts [BR:pmum03110]
 Intramolecular chaperones
  Subtilisin family
   103333208
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 TPPII Prp19
Motif
Other DBs
NCBI-GeneID: 103333208
NCBI-ProteinID: XP_008234235
Position
LG5
AA seq 1351 aa AA seqDB search
MQCPVVLFKLPYLPTSRLSLHSSFLSLIIRPTKLSKARRPRENRSSIGRDRAMPCSAIGG
AGGGGGEANGSLPNFKLNESTFLASLMPKKEIGADRFIEAHPNYDGRGALIAIFDSGVDP
AASGLQVTSDGKPKILDVLDCTGSGDVDTSKVVKADENGSIRGASGASLVVDSSWKNPSG
EWHVGYKLVYELFTDTLTSRLKKERRKKWDEQNQEEIAKALKDLHEFDQKHSKVDDANSK
RAREELQNRVDYLQKQADTYDDKGPVIDAVVWHNGEVWRVALDTQTLEDNPDCGKLADFV
PLTNYRIERKYGVFSKLDACTFVVNVYDEGNIVSIVTDSSPHGTHVAGIATAFHPKEPLL
NGVAPGAQLISCKIGDSRLGSMETGTGLTRALIAAVEHKCDLINMSYGEPTLLPDYGRFV
DLVNEAVNKHRLIFVSSAGNSGPALSTVGAPGGTTSSIIGVGAYVSPAMAAGAHCVVEAP
GEGLEYTWSSRGPTADGDLGVCISAPGAAVAPVPTWTLQQRMLMNGTSMASPSACGGIAL
LISALKAEGIPVSPYSVRKALENTSVPIGSLPEDKLSTGVGLMQVDKAHEYLRQTRGVPC
VWYQIKINQSSKPTPTSRGIYLREGSALQQSTEWTVLVEPKFHEGASNLEELVPFEECIE
LHSSEKAVVKAPDYLLLTHNGRSFNIVVDPTNLSEGLHYYELHGVDCNAPWRGPLFRIPV
TITKPMAVINRPPFSKMSFLPGHIERRFIEVPLGATWVEATMQTSGFDTARRFFIDSLQL
CPLQRPRKWESVVTFSSPGSKSFSFPVVGGQTMELAIAQFWSSGIGSHETTIVDFEIVFH
GININKDEVVLDGSEAPIRIEAEALLASEELAPAAILNKIRIPYRPVESKLFTLPTDRDK
LPSEKRILALTLTYKFKLEDGAEVKPHVPLLNNRVYDTKFESQFYMISDANKRVYAMGDT
YPSSAKLPKGEYNLRLYLRHDNVQYLEKLKQLVLFIERKLEEKDVIRLSFFSEPDGSLMG
NGSYRSSILVPGKKEAIYLGPPSKDKIPKFSPQGSVLLGAISYGKLSYVEKGEGKNPLKN
PVSYQISYIVPPNKLDEDKGKGSSASTKGISERLDEEVRDAKIKVLASLKQDTDEEFSEW
KKLSSSLKSEYPKYTPLLAKILEGLVSQSIIEDKVLHEKEVIDAANEVVDSVDKDELAKF
FALRSDPDDEEAEKIKKKMETTRDQLAEALYQKGLALAEIESLQGDKPPKAEEGAEKTKD
LFEDNFKELKNWVEVKSSKFGTLLVRRERRCKRLGTALKALNDIIQDDGEPPKKKFYELK
ISLLDEIGWKHLVTHEKQWMHVRFPANLPLF
NT seq 4056 nt NT seq  +upstreamnt  +downstreamnt
atgcaatgcccagtagttttattcaaattgccgtatttgcccacgtcacgactctcacta
cactcatcatttctctcactcatcattaggcccacaaagctcagcaaagcaagaagaccg
agagagaatagaagcagcatcggtagagatagggcaatgccttgttctgcaattggtggc
gctggtggaggtggtggtgaggctaatggttctctgcccaatttcaaactgaacgagtcc
acgttcttggcctccctcatgccgaagaaagagattggcgccgatcgcttcatcgaggct
catcccaattacgatggccgtggcgccctcatcgctatcttcgattctggagtggaccct
gctgcttctggattacaagttacatcagatggaaagccgaaaatcctagatgttcttgat
tgtactgggagtggtgatgtcgatacttcaaaggtagtgaaggccgatgaaaacggttct
attcgtggagcttccggagcatctctggttgtcgactcctcatggaaaaatccttctggt
gaatggcatgtgggttataaattggtatacgagttgtttacagatacattgacttctcgc
ttgaagaaagaaagaagaaaaaaatgggatgaacaaaaccaagaagaaattgccaaggct
cttaaggatcttcatgaatttgaccagaaacacagtaaagtggatgatgctaactcgaaa
agggctcgggaggaactgcaaaatagagttgattacctacaaaagcaagctgatacctat
gatgacaaaggccctgtcatagatgctgttgtatggcataatggagaagtatggagggtt
gcccttgacacacagactcttgaggataacccagattgtggaaaacttgcagactttgtg
cccctaactaattataggatagaacgaaaatacggtgtttttagcaaattagatgcctgt
acatttgttgttaatgtttatgatgaagggaatatcgtaagtattgtgacagatagctct
ccccatggcactcatgttgctggtattgctactgctttccacccgaaggagcccctgttg
aatggagttgcacctggagcacaactaatatcttgtaaaattggagactcgcgcttaggt
tcaatggagacaggaactggtttgactcgagccttgattgctgctgtggagcataagtgt
gatttgatcaacatgagttatggagaacctactttactgccagactatgggcgctttgtt
gacctcgttaatgaagccgtgaacaagcaccgtctaatatttgtgagtagtgctggcaat
agtgggccagcactgagcactgttggagcacctggtggtaccacatcaagcattatagga
gttggtgcatacgtctctccagcaatggctgctggtgctcattgtgtggttgaagcccct
ggtgaagggcttgagtacacttggtctagccgtggaccgaccgccgatggagatcttggt
gtctgtataagtgctcctggtgcggctgttgctcctgttcctacatggactcttcaacaa
cgcatgctcatgaatggaacatcaatggcatctccatctgcttgtggaggaattgctttg
ctcataagtgcattgaaggctgaaggtattcctgtgagtccatatagtgtaaggaaggct
cttgaaaatacatctgttccgataggcagtctaccagaagataaactatcaactggagta
gggcttatgcaagttgacaaggcacatgaatatctaaggcagacccggggtgtaccatgt
gtttggtatcagataaagataaatcaatctagtaaaccaacgcctacatcacgaggaata
tacttaagggagggtagtgctttacaacaatctactgagtggaccgtgctagttgaacca
aaatttcacgaaggtgcaagcaatttagaagaattggttccttttgaggagtgcatcgag
ttacattccagtgagaaggcagttgtgaaggctcctgattatctccttcttactcataat
gggcgtagcttcaacatagttgtggatcccaccaaccttagtgaaggtctacactattat
gaactacatggtgttgattgcaatgcaccatggcgcggccctcttttcagaatccctgtt
actataacaaagcctatggctgtgataaatcgacctccattttctaagatgtcatttttg
ccaggccacatagaaaggagatttatagaagtacctcttggtgctacatgggttgaagca
accatgcaaacatcaggatttgatacagcacgaagattttttattgactctcttcagctt
tgtcccctgcaaagacctcgtaaatgggagagtgttgtaacattctcttctccgggttcc
aaaagcttttcatttcccgttgtgggtggtcagacaatggaattagctattgctcaattt
tggtcgagtgggataggaagtcatgaaacaactattgtggattttgagattgtatttcat
gggattaacattaataaagatgaagtagtacttgatggaagtgaagcaccgatcagaatt
gaagctgaagctctactggcttctgaggaacttgcaccggctgctattctaaacaagata
agaattccatatcggccggttgagtctaaactttttactctgccaacagatcgtgacaaa
ctaccctcagaaaaacgtattctggcacttactttaacttacaagttcaaattggaagac
ggagctgaagtaaagcctcatgttccactacttaacaatcgcgtgtacgacactaaattt
gagtctcaattttatatgatctctgatgcaaacaagcgtgtatatgcaatgggtgacact
tatccaagttctgcaaaactgcccaagggtgaatacaatttacggctatatttgagacac
gacaatgtgcaatatttggaaaagttgaagcagctggtgttgttcattgagaggaagttg
gaagagaaggatgtaatccgattgagctttttctccgaacctgatggctctttgatggga
aatggttcttataggtcctccattttagttccagggaagaaagaagcaatctatttgggt
ccaccatccaaagacaaaatcccaaagttttctccacaaggatctgttttactaggagcg
atctcatatgggaagttatcatatgttgaaaagggagaggggaaaaatccactgaagaac
cccgtgtcttatcagatatcatatatagtgccaccaaataagctggatgaggacaaagga
aaaggttcttctgcttccactaagggtatatctgagcgattagatgaagaggttcgagat
gcaaagattaaagttcttgctagcctgaaacaagacactgatgaagaattctcagagtgg
aaaaaattatcttcctctctcaagtctgaataccctaaatacactccattgcttgcgaag
atattggaaggtttggtttctcaaagcattattgaggacaaagtcctccatgaaaaagag
gttattgatgcagcaaatgaggtggttgacagtgttgacaaagatgagctagcaaaattt
tttgcactcagaagtgatcccgatgatgaagaggcagagaaaattaaaaagaagatggag
acaacccgtgatcagttagcagaggcgttgtaccaaaaaggactagcacttgcagagatt
gaatcgttgcagggtgataagccccctaaggctgaagaaggggcagaaaagactaaagat
ttgtttgaagataacttcaaagaacttaaaaattgggtcgaagtgaagtcctctaaattt
ggaaccctcttagtacgtcgtgagagacgttgtaaaaggcttggaacagcgttgaaggct
ttgaatgacataatccaagacgatggagaacctcccaagaagaagttttatgaattgaag
atctccctgcttgatgagattggttggaaacacttggtgacacatgagaaacaatggatg
catgtccgctttccagcaaatttacctcttttctag

DBGET integrated database retrieval system