KEGG   Prunus mume (Japanese apricot): 103334037Help
Entry
103334037         CDS       T03196                                 

Definition
(RefSeq) ATP-dependent RNA helicase DEAH12, chloroplastic-like
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
pmum  Prunus mume (Japanese apricot)
Pathway
pmum03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:pmum00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    103334037
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pmum03041]
    103334037
Enzymes [BR:pmum01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     103334037
Spliceosome [BR:pmum03041]
 Complex C
  Other components
   Step II factors
    103334037
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Helicase_C OB_NTP_bind IBR HA2 DEAD AAA_22 zf-C3HC4 ResIII AAA_19 Helicase_RecD AAA_30 zf-RING_UBOX ABC_tran RsgA_GTPase Herpes_ori_bp AAA_29
Motif
Other DBs
NCBI-GeneID: 103334037
NCBI-ProteinID: XP_008235185
Position
LG1
AA seq 1724 aa AA seqDB search
MRSSCGPYPRATFRQPQPPEIPHRYPPRQPNSLPDGCCRRPPPRPPSFIVVLLSDQRNHR
KADIDAVIAKCKFKPENVEFSPSNVIVVSLFYTQWAHALEAIVCLWESRLDRVHNLTPKL
NRFVSVPSDLEELQDRLRGLFTERIKKLIDGEAVKKCEAKRALLSKEFERVSKLLLRPSP
VWTLDDLAQKKRRSKCEMELVESKIGEFKSAMNCLLAYLDGNGLEECGEEGVQVFKFSSE
VYDWGRIQSIMARECHRLEEGLPIYAYRQQILQQILTQQVLVLIGETGSGKSTQLVQFLA
DSGIAAEQSIVCTQPRKIAATSLAERVTQESSGCYREKSIKFNPTFLSGQELNSKVIFMT
DHCLLQHYMNDMNMSGISCIIIDEAHERSLNTDLLLALIKGLLGRRPSLRLVIMSATADA
EVLSNYYYGCGIFYVVGRSFPVDVRYKPSFSEGTSSDATSYVSDVLRVATEVHKKEKEGT
ILAFLTSQMEVEWACQKFIAPGAIALPLHGKQTFEDQYNVFQNYPGRRKIIFSTNVAETS
LTIPGVKYVIDSGMAKESKFEPASGMNVLRVCRISRSSANQRSGRAGRTEPGICYRLYSK
NDFEAMPPCQEPEIRRVHLGVAVLKILALGIKNLKDFEFIDAPCSEAIDMAMRNLIQLGA
VKQTDDVFELTKDGRFLVKLGVEPRLGKLILGCYNHSLRREGLVLAAVMANSSSIFCRVG
NDEEKLRSDCLKVQFCHRDGDLFTLLSVYKTWDNLAQEKKNTWCWENSINAKTMRRCQEM
VKDLESCLKHELNMIIPSTWCWNPHESNDCDKYLKKVILSSLVENVAMFSGHDQLGYEVA
LSGQHVRLHPSCSLLVFGEKPSWVVFGELLSISNQYLVCVTSIDFNSLSTLSPPPLFDVS
KMESQKLQLKVLTGFGSTLLKRFCGKGNGYLLHLVSRVRSICKDERINIKVDYYQNEITL
FATLHDMDRVSSFVYDALECERKWMRNECLEKCLYHGSGVLPSIALFGAGAEIKHLELQK
RCLTVDVVHSKLDSMDDKELLSELEKYASGSICAIHKFTGTGQESVDKGKSARITFLSPD
VAQKAVELNESEFSGSILKVIPSQVGGDRKMLSFPAVRAKVYWPRRLSRGIAIVKCDVDD
VAYMVNDFFNLLVGGRIVRCETSKRSMDSVVISGLEKDLSEAEILDVLRTATSRRILDFF
LLRGDAVENPPCGACEDALLKEISTFMPKRYSHNSCSIQVFEPEQKNAFMRALITFDGRL
HLEAAKALEQLEGKVLPGFLSWQKMKCQQLFHSSLSCPAPVYPVIKKQLDSLLSSFFQLN
GVEWSLDRNANGSYRVKISANATKTVADLRRRVEELVKGKTIDHASLTPTILQLLFSRDG
IALMHSLERETGTYILFDRRNVSVQVFGSSDQVSVVQQKLVDSLLTLHENKLIEIRLQGS
ALPPELMKEVVNRFGADLHGLKEKVPGADFSLNVRRQVISIHGNKDLKQKVEDNIYEIAQ
MTGSSTERFNSEADCPICLCEIEDEYRLAVCGHLFCRLCLVEQCESAIKNQDSFPMCCAH
EGCRSLIVFSDLRYLLSSEKLEELFRASLGSFIASSGGIYRFCPSPDCSSVYQVAAPGTD
GEPFVCGACYAETCTRCHLEYHPYLSCEQYREFKEDPDSSLKEWCKGKEHVKSCPVCRYT
IEKIDGCNHIECRCGKHICWVCLASYGTSNECYDHLRSVHMAII
NT seq 5175 nt NT seq  +upstreamnt  +downstreamnt
atgagatcgtcgtgcggaccataccctcgcgccactttccgccaacctcagccgccggaa
attccccaccggtaccctcccaggcaacccaattccctgccggacggctgctgtcgtcga
ccccctcccaggcccccgagtttcatcgtcgtgctcctctccgaccaacgtaaccaccgg
aaagccgacatcgacgccgtgatcgctaaatgcaagttcaaacccgaaaacgtcgagttc
tctccctctaatgtcatagtggtctccttgttctacacacaatgggcccacgcgctcgag
gccattgtttgtctttgggaatcgcggctcgaccgggttcataatctgacaccgaagttg
aaccggtttgtttctgtgccgtccgatctcgaggagctccaggaccggctcagaggcttg
ttcaccgaaagaattaagaaattgatcgacggggaagcagtgaagaagtgcgaggcgaag
cgggccctgttgtctaaggaatttgagcgagtttcgaagttacttctgaggccaagccct
gtttggactctggatgacttagctcagaagaagaggaggagtaaatgcgaaatggaattg
gtggagagtaagattggggagttcaagtcggcaatgaactgtttgcttgcttatcttgat
gggaacgggttggaggagtgtggtgaagaaggcgtgcaagtgtttaaattttcaagtgaa
gtttatgattggggtcgaattcagagcataatggctcgggagtgccacaggctcgaagaa
gggttgcccatttacgcttatcggcagcaaattcttcagcaaattcttacccagcaggtc
ctggtgttaattggagaaactggttcaggaaagagtacacagttggtgcagtttcttgct
gattctggaattgctgctgagcagtctattgtatgcactcagcctcgcaagattgctgcc
acgtcgttggccgaaagggttacacaagaaagtagtgggtgttatagagaaaaatcaata
aaatttaatccgacatttttgtcagggcaggagttgaattctaaggtaatatttatgacg
gaccactgtctactgcagcactacatgaatgatatgaatatgtctgggatttcttgcatc
ataattgatgaggctcatgaaaggagcttgaatactgatctccttttggcattgatcaaa
ggtttactaggtcgaagacctagtttacgacttgttataatgtctgcaacagctgatgca
gaagtgctctcaaattattattatggctgtggaatcttttatgtggtggggaggagcttt
cccgttgatgttagatataaaccgtctttcagtgaaggaacttctagtgatgctacttcc
tatgtttctgatgtgctgagggtagcaacggaggtacacaaaaaagagaaagaagggaca
attcttgcctttttgacttcccagatggaagtagaatgggcttgtcagaagtttatagca
cctggtgcaattgcactgccactgcatggaaaacaaacttttgaagaccaatataatgtt
ttccaaaactaccctggaagaagaaaaattatattttccacaaatgtggctgagacatct
ctgacaattcctggggtaaagtatgtgattgattctggtatggctaaagaaagcaaattt
gaacctgcaagtggcatgaatgttctaagagtttgcagaatcagccggagttctgctaat
caaagaagtggccgtgctggaagaacggaacctggtatatgttacagactctactcaaaa
aatgattttgaggcgatgcctccttgccaggaacctgagatccgtagagttcaccttggt
gttgcagttctgaagattttggctttgggcatcaagaatttaaaagattttgaatttatt
gatgcaccttgttctgaagctattgacatggccatgcggaaccttattcagttaggagct
gtgaagcaaactgatgatgtttttgaattaaccaaggatggtcggttcttggttaaattg
ggtgttgagcctcggcttggtaaattaatccttggttgttataaccacagcttacgtagg
gaaggccttgttcttgcagctgtaatggcaaattccagtagtatattttgtagagttggt
aatgatgaagaaaaacttagatcagactgccttaaggtgcaattttgccatcgtgatggg
gatctttttacccttctctctgtgtacaagacatgggataatttggctcaagagaagaaa
aacacatggtgttgggaaaacagcattaatgccaaaactatgaggagatgccaagaaatg
gtaaaggatttggagtcttgccttaaacatgaactcaatatgataattcctagtacctgg
tgttggaatccacatgaatcaaatgattgtgataaatatttgaaaaaggttatactttct
tcccttgtggaaaatgttgctatgttctcgggacatgatcaacttggttatgaagtggca
ttaagcgggcaacatgttcggttgcatccttcgtgttcattgttagtatttggtgagaaa
cctagttgggtagtatttggtgaactcctgtcaatttctaatcaatatttagtctgcgtc
acttccattgatttcaactctttgtctaccctatctcctcctcctttgtttgatgtatct
aagatggaaagtcaaaaattgcaactgaaagttttgactggttttggcagtactctgctt
aaaagattttgtgggaagggcaacggttatctgcttcatcttgtttcacgtgttaggtca
atttgcaaggacgaacgtatcaacattaaagtcgattattatcagaatgagattacgttg
tttgccaccttgcatgacatggatagggtttcaagctttgtatatgatgccttggagtgt
gaacgaaaatggatgcgaaatgaatgtttggagaaatgcttgtatcatggttctggtgtc
ttgccttcaatagcattgtttggagctggtgctgagatcaagcatctggagcttcaaaaa
aggtgtttgactgttgatgtagttcattcaaaactagattctatggatgataaggagtta
cttagtgagcttgaaaagtatgcctctggtagtatatgtgctattcataagttcactggc
actgggcaggaaagtgttgataaaggaaagtcggccaggataacatttttaagtcctgat
gtggctcaaaaagctgttgaactaaatgaatctgaatttagtggctccatactgaaggtt
attccttctcaggttgggggtgatcgtaaaatgttgtcgttccctgctgttagagctaaa
gtttattggcctcgcaggctaagcagggggattgcaattgtcaaatgtgatgtggatgat
gttgcttacatggttaatgatttttttaaccttttagtaggaggaagaattgttcgttgt
gaaactagcaaaagatccatggattctgttgtgatcagtggacttgaaaaagatctttct
gaggctgaaattttggatgtgttgaggactgctacaagtaggagaatcctggattttttt
ctgctgagaggagatgctgtagaaaatccaccatgtggtgcttgtgaagatgctctccta
aaagaaatatcaacctttatgcctaaaagatactcccacaatagctgcagcattcaggtt
ttcgagcctgaacaaaagaatgctttcatgagagctttgattacatttgatggaagatta
cacttggaggcggcaaaagctttggaacaattagaagggaaagtattgcctgggttcctt
tcatggcaaaagatgaagtgccagcagttatttcatagctctctatcctgccctgcccct
gtttatcctgtgatcaagaagcagttggattcgttactttcaagtttttttcaactaaat
ggtgtagaatggagtttagataggaatgctaatggctcctacagagtgaagatatctgcc
aatgctacaaaaacagttgcagacctgagaagacgtgtggaggagcttgtgaaagggaag
acaatagaccatgccagcctcactccaactattttacagcttctgttctccagagatggc
atcgctctaatgcactcactagagagagagacgggaacctatattctttttgacaggcgt
aacgtcagtgtacaggtcttcggttcttcagaccaagttagtgtggtccagcagaaattg
gttgactcccttttaacgctccatgaaaataagctgattgagatccgacttcaaggtagt
gccttacctcctgagttgatgaaagaggttgttaacaggtttggggcagacctccatggg
ctcaaagagaaggtaccaggggctgattttagtctaaatgttcgccgtcaagtcatttcc
attcatggaaacaaggatttgaagcagaaagtagaagataatatttatgagattgcacag
atgacaggtagttcaactgagaggtttaatagtgaagctgattgccccatatgtttgtgt
gagattgaagatgaataccggcttgcggtgtgtgggcatttattttgtcgtttgtgtttg
gtggagcagtgcgagtctgcaataaaaaaccaagatagtttcccaatgtgctgtgcacac
gagggttgcaggtctcttattgtgttcagtgatctgagatatctcttatcaagtgagaag
ctggaggagctctttagggcctcattgggatcatttattgcttcaagtgggggaatctac
aggttttgcccttctcctgactgctcgtctgtgtatcaggtagctgctcctgggacagat
ggtgaaccattcgtatgtggtgcatgttatgctgagacatgtacccggtgccatttagaa
tatcatccatacttgtcgtgtgagcagtaccgggagttcaaggaagatccagattcatca
ttgaaggagtggtgcaaaggaaaagaacatgtgaagagctgcccggtatgcaggtataca
attgagaagatagatgggtgcaaccatatagaatgtaggtgtgggaagcatatttgctgg
gtgtgcttggcgtcttacggaaccagcaatgaatgctatgaccatttgaggagtgttcac
atggccatcatttga

DBGET integrated database retrieval system