KEGG   Prunus mume (Japanese apricot): 103334288Help
Entry
103334288         CDS       T03196                                 

Definition
(RefSeq) probable methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pmum  Prunus mume (Japanese apricot)
Pathway
pmum00450  Selenocompound metabolism
pmum00970  Aminoacyl-tRNA biosynthesis
pmum01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmum00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    103334288
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    103334288
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pmum01007]
    103334288
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pmum03016]
    103334288
Enzymes [BR:pmum01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     103334288
Amino acid related enzymes [BR:pmum01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   103334288
Transfer RNA biogenesis [BR:pmum03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    103334288
 Prokaryotic type
   Other AARSs
    103334288
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e C1_1
Motif
Other DBs
NCBI-GeneID: 103334288
NCBI-ProteinID: XP_008235455
Position
LG6
AA seq 618 aa AA seqDB search
MDDQSDGRQGNGRNLKLPVPGKRNILITSALPYVNNIPHLGTIIGCVLSADVFARYCRLR
GYNAVYICGTDEYGTATETKAREENCTPQQICDKYYAIHKEVYDWFDICFDEFGRTSTPQ
QTEVCQSIFKKLMENGWLTENTMQQLFCETCNRFLADRLVEGSCPMLDCNYDSARGDQCD
KCGKLLNPTELKDPRCKVCQARPCIRDTDHLFLELPLLKDKLEEYISDMSVAGSWSQNAI
QTTYAWLKEGLKSRCITRDLKWGVPVPHEKFKDKVFYVWFDAPIGYISITSCYTPDWEKW
WKNPEDVELYQFMGKDNVPFHTVMFPSTLIGTGEKWTLMKSISVTEYLMYEAGKFSKSKG
IGIFGNDVQDTNIPVEVWRYYLLTNRPEVSDTLFTWTDLQAKLNTELLNNLGNFINRVLS
FIAKPQGLGYGSIIPDASGGESHSLTRRFAERIGICVDQYIEAMEKVKLKQALKIAMSIS
SEGNAYLQESQFWKLFKQDQASCSLVVKTSAGLVYLLACLLEPFMPSFSLKVLKELNLLP
ENQFSLRDENGDLEKAKKPWEILPAGHKIGTPDPLFKELKDEEVEAFRKKFSGSQAERVA
KGEAEARKLAEQLEQTKV
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atggatgatcaatcagacggcagacaaggcaacggcagaaatctgaagctaccggtgccg
ggaaagcgcaacatactcatcacaagcgccttgccatacgtcaacaacatccctcacctt
ggcaccatcataggctgtgttctgagtgctgatgttttcgctcgatattgtcgtcttcgt
ggatacaatgcggtgtacatatgtgggactgatgagtatgggactgcaacagagacaaag
gctagggaggaaaattgcactccacagcaaatttgtgacaaatattatgcaattcataaa
gaggtctatgattggttcgatatatgtttcgatgaatttggacgcacctccactccccaa
cagactgaagtttgccaatctattttcaagaaactgatggagaatggatggcttacagaa
aacacaatgcagcagctcttttgtgaaacatgcaatcgtttcttggctgatcggctagtt
gaaggcagttgtccaatgctagattgcaattatgactctgcacgaggggaccaatgcgat
aagtgtggaaagctgttgaatccaactgagcttaaggatcctagatgtaaagtatgtcag
gcaaggccatgtatacgtgacacagaccacttatttctagagctcccactgttgaaggat
aaattggaagaatatatcagtgacatgtctgttgcaggatcttggagccagaatgctatt
caaactacatatgcatggcttaaagaaggacttaaatcccgatgcattacgagggacctt
aagtggggggttcctgttccacacgaaaaatttaaggacaaggttttttatgtatggttt
gacgcgcccatcggttatatctccatcacttcgtgctacacgcctgattgggagaagtgg
tggaagaaccctgaagatgttgagctgtaccagttcatgggcaaggataatgtcccattc
cacaccgttatgttcccatctacgcttattggaactggagaaaagtggactttaatgaag
agcattagtgttaccgaatatttaatgtatgaagcagggaagttttccaagagcaagggt
ataggaatttttggcaatgatgtgcaagatacaaacattcctgtagaagtgtggcgatat
tacttgctaactaacaggccagaggtctcagatacattgtttacatggacggacttgcaa
gcaaaactaaatactgagctgctgaataacttgggaaatttcattaaccgagtgttgagc
ttcatcgcaaaacctcaaggactaggatatggatctattattcctgatgcttctggtggt
gaatcacattccttgacaagaaggtttgcagaaagaattggtatatgtgtggaccaatac
atagaagcaatggagaaggtcaagttaaagcaagcactgaaaattgcaatgagcatatcc
agtgagggcaatgcatatttacaagagagccaattctggaaacttttcaagcaagatcaa
gcttcttgctctcttgtcgtgaaaacttctgctggactggtttatctgcttgcatgcttg
ctagagcctttcatgccttcattttctctcaaggtgctaaaggagctcaatctgctgccc
gaaaatcaattttcgcttcgtgatgagaatggagatcttgagaaggcaaagaaaccatgg
gaaatattacctgcgggtcataagattgggacaccagatcctttgtttaaagaattgaaa
gatgaagaagtggaggccttcaggaagaagttttctggaagtcaagctgaaagggttgct
aagggagaagctgaagcaaggaaattagctgagcaattggagcaaacaaaagtttaa

DBGET integrated database retrieval system