KEGG   Prunus mume (Japanese apricot): 103335542Help
Entry
103335542         CDS       T03196                                 

Definition
(RefSeq) phosphoenolpyruvate carboxykinase [ATP]-like
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
pmum  Prunus mume (Japanese apricot)
Pathway
pmum00010  Glycolysis / Gluconeogenesis
pmum00020  Citrate cycle (TCA cycle)
pmum00620  Pyruvate metabolism
pmum00710  Carbon fixation in photosynthetic organisms
pmum01100  Metabolic pathways
pmum01110  Biosynthesis of secondary metabolites
pmum01200  Carbon metabolism
Module
pmum_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
pmum_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
Brite
KEGG Orthology (KO) [BR:pmum00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103335542
   00020 Citrate cycle (TCA cycle)
    103335542
   00620 Pyruvate metabolism
    103335542
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    103335542
Enzymes [BR:pmum01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     103335542
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPCK_ATP AAA_24 AAA_33 AAA_16
Motif
Other DBs
NCBI-GeneID: 103335542
NCBI-ProteinID: XP_008236782
Position
LG1
AA seq 570 aa AA seqDB search
MAFGETETQPETQTPEVVQAKKYDQNDVDKVSHFTPTICVSDSAFKFANVLYNLTPAELY
EHAVKYEKGSFITSTGALATQSGAKTGRSPRDKRVVKDATTQDDLWWGKGSPNIEMDEHT
FMINGERAVDYLNCLDKVFVNDQFLNWDSENKIKVRIVSARAYHSLFMHNMCIRPTKEEL
ENFGTPDFTIYNAGKFPCNRYTHYMTSSTSVDLHIARKEMVILGTMYAGEMKKGLFSVMH
YLMPKRQILSLHSGCNMGKSGDVALFFGLSGTGKTTLSTDHNRYLIGDDEHCWSDKGVSN
IEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDDHTRLVNYADKSVTENTRAAYPIE
FIPNALIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKE
PTATFSACFGAAFLMLHPTKYAAMLAEKMQTHGATGWLVNTGWSGGSYGSGSRIKLAYTR
KIIDAIHSGSLLKTEYKKTEVFGLEIPSEVEEVPSEILDPVNTWSDKNAYNETLMKLAGL
FKNNFATFTNYQIGEDNKLTEEILAAGPHC
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atggctttcggtgagactgagacccaaccagaaacacagacacccgaggtcgttcaggct
aagaagtatgaccagaacgatgttgataaagtgtcacatttcacccccactatttgcgtc
agtgacagcgcctttaagttcgccaacgtcctctacaaccttactcctgctgagctatat
gagcatgctgtcaagtacgagaaggggtcgttcatcacgtccaccggcgcattagcaact
caatcgggagccaagactggtcggtctccaagagataagcgtgttgtcaaggacgctact
actcaggatgatctttggtggggaaagggttcccccaacatcgaaatggacgagcacacg
ttcatgattaacggggaaagagctgtagattacttaaattgtttagacaaggtctttgtg
aatgaccaatttctgaactgggattcagaaaacaaaatcaaagtgaggattgtctctgct
agggcttaccactcactgttcatgcacaacatgtgcatccgacccactaaagaagagctg
gagaatttcggcactccggacttcactatctacaatgctggcaagttcccttgcaaccgt
tacacacactacatgacatcctctactagcgttgatctccatattgctaggaaggagatg
gtcattcttggaaccatgtatgccggtgaaatgaagaagggcctcttcagtgtcatgcat
tatctcatgcccaagcgccaaatcctctccctccactctggctgcaatatggggaagagt
ggagatgttgccctcttctttggtttgtcaggtaccggtaagacaaccctttccactgat
cacaacaggtacttgatcggagatgatgagcactgctggagcgacaaaggtgtgtcaaac
atcgaaggtggttgctatgccaagtgcattgacctctccagggagaaggagcctgacatt
tggaacgccataaagtttggcgctgtgctggaaaatgttgtgttcgatgatcacacccga
ctggtgaactatgcagacaaatctgttacagagaacactcgtgcagcctaccccatcgaa
ttcatccccaacgcactgatcccatgtgttggcccccaccctaagaatgtcattcttctg
gcatgtgatgcatttggtgtgctcccacctgtgagcaagctgaacctggcacagaccatg
taccacttcatcagtggctacactgccctggttgctggaactgaagatggtatcaaggag
ccaacggccacattctcagcctgctttggtgcagcatttctaatgctgcatcctaccaag
tatgcagcaatgttggctgagaagatgcagacgcatggtgcaactggatggctggtgaac
actggctggtctggtggaagctatggatccggaagccgcatcaagctagcctacacaagg
aaaatcattgatgccatccactccggcagcctgttgaagacagagtataagaagaccgaa
gtgtttggacttgagattcctagtgaggttgaggaagtgccctcagaaatacttgatcct
gtgaacacttggtcagacaagaatgcatacaatgagacactgatgaagctggctggcctg
ttcaagaacaactttgcgaccttcacaaattaccagattggtgaggacaacaagctgact
gaggagatacttgcagctggtccccactgctga

DBGET integrated database retrieval system