KEGG   Prunus mume (Japanese apricot): 103335900Help
Entry
103335900         CDS       T03196                                 

Definition
(RefSeq) tyrosine/DOPA decarboxylase 1-like
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
pmum  Prunus mume (Japanese apricot)
Pathway
pmum00350  Tyrosine metabolism
pmum00360  Phenylalanine metabolism
pmum00380  Tryptophan metabolism
pmum00950  Isoquinoline alkaloid biosynthesis
pmum00965  Betalain biosynthesis
pmum01100  Metabolic pathways
pmum01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmum00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    103335900
   00360 Phenylalanine metabolism
    103335900
   00380 Tryptophan metabolism
    103335900
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    103335900
   00950 Isoquinoline alkaloid biosynthesis
    103335900
   00965 Betalain biosynthesis
    103335900
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pmum04147]
    103335900
Enzymes [BR:pmum01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     103335900
    4.1.1.105  L-tryptophan decarboxylase
     103335900
Exosome [BR:pmum04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103335900
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 103335900
NCBI-ProteinID: XP_008237161
Position
LG1
AA seq 543 aa AA seqDB search
MDSLKLDHPQENNSNSSPMEMTSALDPVEFRRQGHMMVDFIADYYQNIDKYPVLSQVDPG
YLRKRLPESAPDNPEPIETILQDVQEHIVPGLTHWQSPSFFAYFASNVSIAGFLGEMLST
GFNVVGFNWMSSPAATELESIVMDWLGNLLRLPKSFLFSGNGGGVIHGSTCEAIVCTMAA
SRDQMLSRIGGDNIGKLVVYGSDQTHSALQKASQIVGINPKNFRAIEATRSTTFALSPES
LKLAISSDIEAGLVPLFLCATVGTTATTAVDPLGPLCDVAIRHGMWVHVDAAYAGSTCIC
PEFRHFIDGIEGVDSFSFNAHKWFFTGLDCCCLWVKNPGSLTSSLSANPEFLRNKPTDSK
QVVDYKDWQIALSRRFRAMKLWLVLRSYGVVNLRNFLRSHVKMAKLFEGLVAMDQRFEIV
VPRNFSMVCFRVSPWVATSKGAPTTPTSNSFHQNGIEINVEKCTNEVNCKLLEAINASGR
VFMTHAMVGGMYVIRCAVGVTLTEEKHIAMAWKVVKEHADVILKNHGDDGEANLKLPLLD
MIA
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggatagcctcaagctcgaccatccacaagaaaacaacagcaattcttcccccatggaa
atgactagcgctctggatcctgtggaattcaggaggcaaggccacatgatggtagacttc
atagcagattattaccaaaacatagacaagtacccagtcctaagccaagtcgatccgggt
tatctccgaaagcgcttgccggagtccgccccagataacccagagcccattgagaccatc
ctccaagatgtgcaggaacatattgttcctggcctaacacattggcaaagtcctagcttc
tttgcatactttgcttcaaatgttagcatagcagggtttcttggtgaaatgcttagtacc
gggttcaatgtggtgggcttcaattggatgtcatctccagcagcaactgagctagaaagc
atagtcatggattggcttggaaacctgcttaggcttcccaagtctttccttttctctggc
aatggtggtggtgtaatccatgggagcacttgtgaggccattgtttgcaccatggcagct
tccagggatcaaatgctaagccgaattggtggagacaacatagggaagctagttgtgtat
ggatcagaccaaacacatagtgcacttcaaaaggcttcccaaattgttggaatcaacccg
aagaatttccgggccatcgaggctaccaggtcaacaacatttgcactatcacctgaatct
ttaaaattggcaatatcttcagacatagaagctgggctggtgccattgtttttatgtgcc
accgttggaacaaccgcaaccactgcggttgatccattaggcccactatgcgatgttgcg
atacgtcatggtatgtgggttcacgtggatgcggcatatgcagggagtacatgcatttgc
cccgagtttcgccatttcattgatggcattgagggtgtggattcatttagcttcaatgca
cacaaatggttctttactggactcgattgttgctgtctctgggttaagaatccaggctca
ttgacaagttcactctcagccaatccggagtttttgaggaacaagccgacagattcaaag
caagtggtggactacaaggactggcaaatagccctaagccggaggttccgggccatgaaa
ctatggcttgtgcttagaagctatggcgtggttaaccttagaaactttcttaggagccat
gtcaaaatggccaagctttttgaagggcttgtagctatggaccaaaggtttgagattgtg
gtgcctagaaatttctccatggtttgctttagggtttcaccatgggttgcaacaagcaag
ggcgctccaacaactccaacttcaaatagttttcatcaaaatggtattgagattaatgtt
gaaaaatgtacaaatgaagtcaattgcaagttgctggaggccatcaatgcatcgggtcgt
gtattcatgactcatgccatggttggaggtatgtacgtgatacggtgcgcagtgggtgta
accctaacagaggaaaaacacatagccatggcctggaaagtggtgaaagagcatgcagat
gtcatcctcaagaaccatggtgatgatggtgaggcaaatttgaagcttccattgttggac
atgattgcatga

DBGET integrated database retrieval system