KEGG   Prunus mume (Japanese apricot): 103335920Help
Entry
103335920         CDS       T03196                                 

Definition
(RefSeq) 3',5'-nucleoside bisphosphate phosphatase
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
pmum  Prunus mume (Japanese apricot)
Brite
KEGG Orthology (KO) [BR:pmum00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    103335920
Enzymes [BR:pmum01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     103335920
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-GeneID: 103335920
NCBI-ProteinID: XP_008237177
Position
LG6
AA seq 449 aa AA seqDB search
MVGDGFIINHSTNSSNKLESPKKTKKKKKRGGTKKKMTTEQTLAFKSVSEWVFLEQASSL
PSTAASCVVDDFGVQKSLGRGGDKVVFELHSHSKCSDGFLSPSKLVERAHGNGVKVLALT
DHDTMSGIPEALEAARRFRIKIIPGVEISTKFYPRGDSEPEEPVHILAYYSSCGPTSFED
LEKFLSNIRDGRYLRAKTMVSKLNMLKLPVKWEHVSRIAGKGVAPGRLHVARALVEAGYV
ENLKQAFSRYLFDGGPAYSTGSEPLAEEAIQMICDTGGVAVLAHPWSLKNPVTIIRRLKE
AGLHGIEVYRSDGKLAVYSDLADTYDLLKLGGSDYHGRGGHGESELGSVNLPVLVLRDFL
KVARPIWCRSIRHILENYAEEPSDFNLAKITRFGKGVSPLSCGKDLIDRCLSSWLTNEER
QNAVFEAVRLKLSHVSINQGGIQVPIESK
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atggtgggtgacggctttatcattaaccacagcacgaacagttccaacaaattagagagc
ccaaagaaaacaaagaagaagaagaagcgtggtggtaccaagaagaagatgaccaccgag
cagactttggctttcaagtctgtgagtgaatgggttttcttggaacaagcttcttcactg
ccttccactgcagcttcttgtgttgtcgatgattttggggtacagaagagccttggaaga
ggtggagacaaggtagtgttcgaattgcattcacattcaaaatgcagtgatgggtttctt
tcgccttccaagttggtggagagggctcatggaaatggggtgaaagttcttgctctgaca
gatcatgacacgatgtctggcatacctgaggccctggaagcagctcggagatttcgcata
aagataattccaggtgttgaaatcagtacaaaattctacccaagaggagattctgaacca
gaggaaccagtacacatccttgcatattacagcagctgcgggccaacaagttttgaagat
ctggaaaagttcttgtctaatataagggatggtcgttatcttcgtgcaaaaactatggtt
tccaaactgaacatgctcaagttgcctgttaaatgggagcatgtctcaaggattgcaggc
aagggagttgctcctgggagactgcatgtggcccgtgcgctggttgaagcaggttatgtg
gaaaacctgaaacaagctttttcccgctatcttttcgatggtggacctgcatactcgacg
ggaagcgaacctctggcagaagaagcaatacaaatgatttgtgatacaggaggtgtggct
gtgctagctcatccttggtcattgaaaaatccagtgaccatcataagaaggttgaaagaa
gctggtcttcacgggattgaagtttacagaagtgatggaaaactggctgtgtacagtgat
ctagctgacacttatgatcttctgaagcttggagggtcagattatcatgggagaggtggg
catggtgagtctgagctgggtagtgtgaaccttccagtgctggttttgcgtgactttctt
aaagtagctcggccaatttggtgtcgttccattagacacattttagaaaattatgccgaa
gagccttcagattttaatctagcaaagattacaaggtttgggaagggagtttccccctta
agctgcggcaaggatttgattgatcgctgcttgtcttcgtggttgacaaatgaagagagg
caaaatgcagttttcgaggccgtcagattgaagctttctcatgtttcaattaatcaggga
ggaatccaggttcctatagagagtaaataa

DBGET integrated database retrieval system