KEGG   Prunus mume (Japanese apricot): 103338355Help
Entry
103338355         CDS       T03196                                 

Definition
(RefSeq) uncharacterized protein LOC103338355
  KO
K06195  ApaG protein
Organism
pmum  Prunus mume (Japanese apricot)
Brite
KEGG Orthology (KO) [BR:pmum00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    103338355
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF525 UVR DUF4354 CBM49
Motif
Other DBs
NCBI-GeneID: 103338355
NCBI-ProteinID: XP_008239776
Position
LG7
AA seq 296 aa AA seqDB search
MHSLSLKVCTDYCSGTRTCLPGRGSFGAANSELRNLRVGPGFRDFGKSGRVVACVPERNG
NSRSGSPSSSSSPSSGAGQKSSSFLSRSQSWALLKQQMEVAANTEDYEEAARIRDSLKLL
EEEEPILWLRRKIKEAIAEERFEDAAKYRDELKAIAPYSFLKCSSDATTLGIRVQVRSVY
IEGRSQPSKGQHFFAYRIRISNNSDRPVQLLRRHWIITDANGKSENVWGIGVIGEQPVIL
PQASFEYSSACPLSTPTGRMEGDFEMKHINRVSSQSFNVAIAPFSLSVLGDDIDTF
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgcattccctgagcctcaaagtctgcactgattactgctcggggacgaggacgtgtttg
ccgggccgggggagcttcggtgctgcgaattcggagctccggaacttgagagtcgggccg
gggtttagagatttcgggaaatcgggtcgggtcgtggcgtgtgttccggagaggaatgga
aatagccggagcggaagtccgagttcgagttcgagcccgagttcgggtgcgggtcagaaa
tctagttcgtttctttctcggagtcaaagctgggctttgttgaagcagcaaatggaggtt
gctgcaaataccgaggattatgaagaggctgcgaggatacgcgactcgttgaagttgtta
gaagaagaagagccgattttgtggctccgaaggaagataaaggaggcaatcgctgaagag
aggtttgaggatgcagctaagtatcgagatgagctaaaggcaattgccccttactctttc
ttgaaatgttcaagtgatgcaaccaccttgggcattcgggttcaagttagaagtgtgtac
atagagggacgaagtcagccttcaaaggggcaacacttctttgcatatagaatacgaatt
agcaataactcagatcgccctgttcaacttcttagaagacattggattatcactgatgca
aacggaaaatccgagaatgtatgggggattggggttatcggtgaacagcctgttattctc
cctcaagctagttttgaatactcatctgcctgcccattaagcactcccaccggaagaatg
gaaggtgactttgagatgaaacacatcaatagggtaagttcacaatcatttaacgtggct
attgccccattttccctctcagtattgggagatgacattgacaccttttga

DBGET integrated database retrieval system