KEGG   Prunus mume (Japanese apricot): 103339736
Entry
103339736         CDS       T03196                                 

Definition
(RefSeq) delta(14)-sterol reductase-like
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
pmum  Prunus mume (Japanese apricot)
Pathway
pmum00100  Steroid biosynthesis
pmum01100  Metabolic pathways
pmum01110  Biosynthesis of secondary metabolites
Module
pmum_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:pmum00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    103339736
Enzymes [BR:pmum01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     103339736
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 103339736
NCBI-ProteinID: XP_008241298
Position
LG8
AA seq 369 aa
MDLGHVLHLLIPSWNSVAILALFFAYLAIAGSILPGKVVPGATLTDGSRLYYRCNGLISL
LLLVGLLGLGAKMDSVSLTAISDRGFELLSTTFLFSVLVTLVLYAAGCKSSNRGSSLKPH
VTGNLLHDWWFGIQLNPQFMGIDLKFFFVRAGMMGWLFINLSVLARSIQDGTLSQSMILF
QLFCVLYILDYFFHEEYMTSTWDIIAERLGFMLVFGDLVWIPFTFSIQGWWLLSNKVELG
TAAVVANCFTFLIGYMVFRGANKQKHVFKKNPKAPIWGRPARVIGGKLLASGYWGIARHC
NYLGDLLLALSFSLPCGISSPVPYFYPIYLLILLIWRERRDEARCAEKYKEIWAEYRKLV
PWRILPYVY
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggatctgggtcatgttctccacctcctaattccctcatggaactctgttgctatactc
gcattgttctttgcttacttggccattgccggatctatattgcccggcaaagttgttccc
ggagccaccttaacagatggctctcgtctttattatcgctgcaatggtctgatatcactt
ctgttgctggttgggcttcttgggcttggtgctaagatggattccgtatcacttactgca
atatcagacagaggatttgagctgttatcaacaacttttctgtttagtgttctggtcaca
ctggtactttacgctgctggctgcaagtctagcaaccgaggttcttccctaaagcctcat
gtgacagggaaccttctacatgactggtggtttggaatacagcttaatcctcagtttatg
ggcattgacctcaaatttttctttgttagagctggaatgatgggctggctttttatcaac
ctttcggttcttgcgagaagtatccaagatggcaccttgagtcaatccatgatcctcttc
cagttgttctgtgtgttatacatcctggactacttttttcatgaggagtacatgacctcc
acatgggacataattgcagagagactgggtttcatgcttgtatttggagatctagtgtgg
attcctttcacttttagcatccagggatggtggcttctgagtaacaaggtggagttagga
acagctgctgttgtagcaaattgtttcacttttctgatcgggtacatggtattcagagga
gccaacaagcaaaagcatgtctttaagaagaatcctaaagcacctatatggggtaggcct
gcaagggtcattgggggaaagttgcttgcttctggttattggggaattgcaaggcactgt
aattaccttggggacttgttacttgcactgtctttcagtttaccgtgtggaataagttcc
ccagttccatacttctatccaatttatcttctcattctgctcatatggagagaaagaaga
gatgaagctcgttgtgcagagaagtacaaagaaatctgggcagaataccgcaaacttgtc
ccatggagaatattgccttatgtttattaa

DBGET integrated database retrieval system