KEGG   Prunus mume (Japanese apricot): 103342510Help
Entry
103342510         CDS       T03196                                 

Definition
(RefSeq) thiamine thiazole synthase, chloroplastic
  KO
K03146  cysteine-dependent adenosine diphosphate thiazole synthase [EC:2.4.2.60]
Organism
pmum  Prunus mume (Japanese apricot)
Pathway
pmum00730  Thiamine metabolism
pmum01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmum00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    103342510
Enzymes [BR:pmum01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.60  cysteine-dependent adenosine diphosphate thiazole synthase
     103342510
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thi4 DAO FAD_binding_2 NAD_binding_8 Pyr_redox_2 GMC_oxred_N HI0933_like Lycopene_cycl FAD_oxidored GIDA NAD_binding_9 Pyr_redox_3 FAD_binding_3 RNA_pol_Rpb1_3 Pyr_redox K_oxygenase
Motif
Other DBs
NCBI-GeneID: 103342510
NCBI-ProteinID: XP_008244366
Position
Unknown
AA seq 360 aa AA seqDB search
MASMASTLTSSSLTTKLQKPSLLDSSFHGTPVVRLQPAKAATNSNNHGLSVSMSANGSTP
SYDLSAFKFDPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPNVQ
VAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLNELGIAYDETDHYVVIKHAALFTSTI
MSKLLARPNVKLFNAVAAEDLIVKGGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVS
SCGHDGPMGATGVKRLRSIGMIESVPGMKALDMNAAEDAIVELTREIVPGMIVTGMEVAE
IDGSPRMGPTFGAMMISGQKAAHLALKSLGLPNALDGSYVGSIQPELILAAADSAEIAEA
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggcatccatggcttctactctcacctcctcctcccttaccaccaagctccagaagccc
tctctcctcgactcctccttccatggcactcccgtcgtccgccttcagcccgccaaggcc
gccaccaactccaacaaccatggcctctctgtttccatgtccgccaacggctcgacgccg
tcgtacgacctcagcgccttcaagttcgaccccatcaaggagtccatcgtctccagggag
atgaccaggcgctacatgaccgatatgatcacctacgctgacaccgacgtcgtcgtcgtc
ggagccggatccgccggtctctcctgcgcctacgagctcagcaagaaccccaacgttcag
gtcgccattatcgagcagtccgtcagccccggcggtggtgcgtggctcggtggccagctc
ttctccgccatggttgtgcgtaaaccagctcacctttttctaaatgagctcggcattgcc
tacgatgagacagaccactacgttgtcatcaagcacgccgccctattcacctccactatc
atgagcaagctccttgctcggcccaacgtgaagctcttcaacgctgtggctgctgaggac
ctgatcgttaaaggtggaagagttggtggtgtggtcaccaactgggcattggtctcgatg
aaccacgacacacagtcgtgcatggaccctaatgtcatggaggccaaggttgttgtgagc
tcctgcggtcacgacgggcccatgggagccactggggtcaagaggttgcggagcattggg
atgatcgagagcgtgcccgggatgaaggccttggacatgaacgcggctgaagatgccatc
gtggagctgacaagggagattgtgcctggaatgatcgttacaggcatggaagttgctgag
atagatggatctccaagaatgggacctacgtttggagccatgatgatatcagggcaaaag
gcagcccacttggcattgaagtcactagggcttcccaacgctttggatggatcatatgtg
ggtagcattcaaccggagctgatcttggctgctgcggattctgctgagattgcggaggct
taa

DBGET integrated database retrieval system