KEGG   Prunus mume (Japanese apricot): 103342654Help
Entry
103342654         CDS       T03196                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain, chloroplastic
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
pmum  Prunus mume (Japanese apricot)
Pathway
pmum00630  Glyoxylate and dicarboxylate metabolism
pmum00710  Carbon fixation in photosynthetic organisms
pmum01100  Metabolic pathways
pmum01110  Biosynthesis of secondary metabolites
pmum01200  Carbon metabolism
Module
pmum_M00165  Reductive pentose phosphate cycle (Calvin cycle)
pmum_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
pmum_M00532  Photorespiration
pmum_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:pmum00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    103342654
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    103342654
Enzymes [BR:pmum01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     103342654
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small RbcS
Motif
Other DBs
NCBI-GeneID: 103342654
NCBI-ProteinID: XP_008244506
Position
Unknown
AA seq 182 aa AA seqDB search
MASMISSPTVASVYADRAAPAQASLVAPFTGLKSASAFPGTKKTNDITSIASNGGRVQCM
KVWPTVGLKKFETLSYLPPLSPESLAKEVDYLLRKNWVPCLEFELEKGFVYRENHRSPGY
YDGRYWTMWKLPMFGCTDSSQVLKELEEAKKANPNSFIRIIGFDNVRQVQCISFIAYKPA
GY
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggcctccatgatttcttcccccaccgtggcttcggtttacgctgaccgtgcggcccca
gcacaagctagcttggttgcacccttcactggcctcaagtctgcctcagctttccccggc
accaagaagaccaatgacatcacctccattgcaagcaacggtggaagagtgcaatgcatg
aaggtgtggcctacagtcggactgaagaagttcgagactctctcctaccttccaccactc
tctcctgagtctttggccaaggaagtagactaccttctccgcaaaaactgggttccctgc
ttggaatttgagttggagaagggatttgtgtaccgtgagaaccacaggtcaccagggtac
tatgatggaaggtactggaccatgtggaagctgcccatgtttggatgcacagactcttcc
caagtgttgaaagagctcgaggaggccaagaaggctaaccccaactcattcatccgtatc
atcggattcgacaacgttcgtcaagtgcagtgcatcagtttcatcgcctacaagcctgca
ggctactaa

DBGET integrated database retrieval system