KEGG   Prunus mume (Japanese apricot): 103344524Help
Entry
103344524         CDS       T03196                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: glutamate--tRNA ligase, cytoplasmic
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
pmum  Prunus mume (Japanese apricot)
Pathway
pmum00860  Porphyrin and chlorophyll metabolism
pmum00970  Aminoacyl-tRNA biosynthesis
pmum01100  Metabolic pathways
pmum01110  Biosynthesis of secondary metabolites
Module
pmum_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:pmum00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    103344524
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    103344524
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pmum01007]
    103344524
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pmum03016]
    103344524
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:pmum02048]
    103344524
Enzymes [BR:pmum01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     103344524
Amino acid related enzymes [BR:pmum01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   103344524
Transfer RNA biogenesis [BR:pmum03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    103344524
 Prokaryotic type
   Other AARSs
    103344524
Prokaryotic defense system [BR:pmum02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    103344524
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1c tRNA-synt_1c_C GST_C_2 GST_C tRNA-synt_1e GST_C_3 GST_C_6
Motif
Other DBs
NCBI-GeneID: 103344524
NCBI-ProteinID: XP_008246342
Position
LG1
AA seq 733 aa AA seqDB search
MALMERDRETILSEIKVLSFPAESPPLSVLVAAKLAGISLPTDNSLSADSPHLLHFSDGL
KLHGTFVLLRYIGRIANLYGENAIQATQIDEWLEYAPVLSQGAAFENACKHLDDYLGSRT
FFVDHSFSIADIAIWSGLAGTGQRWESLRKSKKYQNLSRWFNSLLAEYGDALNEVTATFV
GKRGLGKPTETKSKGTQANQESKSVNGDVSEKGKAGSRSTFEVDLPEAEMGKVRLRFAPE
PSGFLHIGHSKAALLNQYFAQRYQGQLIVRFDDTNPAKESNEFVDNLLKDIETLGIKYET
VTYTSDYFPQLMEMAENLIRQGKAYVDDTPREEMQKERMDGIESKCRNNSVEENLKLWKE
MIAGSDRGLQCCVRGKLDMQDPNKSLRDPVYYRCNPMPHHRIGSKYKIYPTYDFACPFVD
SIEGITHALRSSEYHDRNAQYYRIQEDMGLRKVHIYEFSRLNMVYTLLSKRKLLWFVQNE
KVNGWDDPRFPTVQGIVRRGLKVEALIQFILEQGASRNLNLMEWDKLWTIXXXXXXXXXX
XXXXVXTLINGPEKPFVRIIPRHKKYEGAGEKATTYTRTIWLESADAESIKVDEEVTLMD
WGNAIVKGIEKDQDGNLKLTGVLNLEGSVKTTKLKLTWLPQTDELVKLCLMEFDYLITKK
KVEEGEDFLDVLNPCTEKETAALGDSNMRNIKRGDILQLERKGYYRCDVPYIRSSKPIVL
FAIPDGRQQTGFK
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atggctttaatggaaagagatagggaaacgattttgagtgagattaaggtgctttcgttc
cccgccgagagccctccgctctcggtgctcgtggcagccaagctcgccggaatttctctc
cccaccgacaactcgctatccgctgattctcctcatcttttgcacttctccgatgggttg
aaattacatggaacttttgtgcttctgcgatatatcggtcgaattgctaacttgtatggg
gagaatgcaatccaagctactcagattgatgagtggcttgagtacgcgcctgtgctttca
cagggtgctgcgtttgagaatgcatgcaaacatttggatgactatttgggaagccgaact
tttttcgttgatcactctttttccattgccgatatagcaatctggtcaggtcttgcagga
actgggcaaagatgggaaagtttgaggaagtcaaaaaagtaccaaaacctttctcggtgg
ttcaattcgctattagcggaatatggtgatgccctgaatgaagtcacagctaccttcgtt
ggcaagagaggcttgggaaagccaacagaaactaaatcaaaaggcactcaagccaatcag
gaatcaaagagtgtaaatggagatgtatctgagaaaggtaaagcaggaagcagatcaaca
tttgaagtagatctgccagaagctgagatgggaaaggttcgactgagatttgcacccgaa
cccagtggctttcttcacattgggcactcaaaagcagctttgttgaatcagtattttgct
caaaggtatcagggtcagcttattgtgcgatttgatgatacaaatcctgcgaaagagagc
aatgagtttgtggacaatcttctcaaggatattgagactttgggcatcaagtatgaaaca
gttacctatacttcagattacttccctcagttgatggaaatggctgagaatttgattcgc
cagggtaaagcatatgttgatgacacaccacgtgaggagatgcagaaggaaaggatggat
ggcattgaatcaaaatgcagaaacaacagcgtagaggagaatctaaaactatggaaagaa
atgattgctggttctgataggggtctgcagtgctgtgtccgtgggaagctggatatgcag
gatccaaacaaatctcttcgggatccagtttattatcgttgcaatccaatgccacatcat
aggattggatccaagtacaagatatacccaacttatgattttgcgtgtccctttgttgat
tctatagaaggtattacccatgcacttcgatctagtgagtatcacgaccgcaatgctcag
tactatcgaattcaagaggatatgggactgcgaaaagtgcatatatatgaatttagtagg
ttgaacatggtttatacacttctcagcaagcgcaagcttttgtggttcgttcaaaatgag
aaggttaatggatgggatgatcctcgttttccaactgttcaaggaattgtgcgcagaggt
cttaaagttgaagctttaatacaattcattcttgagcagggagcttcaaggaatcttaat
ctcatggaatgggacaaactctggaccattaannnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnngttnngacgctgattaatggccctgagaaaccttttgttcgcatcatt
cccaggcacaagaagtatgaaggtgctggagagaaggcgacaacatacacaaggacgata
tggctagagtctgctgatgcagagtccatcaaggtagatgaggaagtgaccttgatggat
tgggggaatgccattgtcaaagggattgagaaagaccaagatggaaacctcaaactcaca
ggggttttgaatcttgaggggtccgtcaagacgacgaaattgaagcttacgtggctaccc
caaacagatgaactagttaagctgtgtttgatggagtttgactacctgatcacaaagaag
aaggttgaggaaggagaagatttccttgatgtacttaacccctgtacagaaaaggagact
gcagcccttggggactccaacatgcgaaatatcaagcgaggggatatattgcagcttgag
aggaaaggttattacagatgtgatgttccctacattaggtcttcaaagccaatcgttcta
ttcgcaatccccgacggcaggcagcagaccggattcaagtga

DBGET integrated database retrieval system