KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107282392Help
Entry
107282392         CDS       T05763                                 

Definition
(RefSeq) very long-chain acyl-CoA synthetase
  KO
K08746  solute carrier family 27 (fatty acid transporter), member 2 [EC:6.2.1.- 6.2.1.3]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur03320  PPAR signaling pathway
pmur04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107282392
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    107282392
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pmur01004]
    107282392
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pmur02000]
    107282392
Enzymes [BR:pmur01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     107282392
    6.2.1.-  
     107282392
Lipid biosynthesis proteins [BR:pmur01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   107282392
Transporters [BR:pmur02000]
 Solute carrier family (SLC)
  SLC27: Fatty acid transporter
   107282392
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 107282392
NCBI-ProteinID: XP_015665651
Position
Unknown
AA seq 620 aa AA seqDB search
MLDFYTILLGILFLLPLLANIFFPYLWLDLRFFFSLLRTGYKSQKRLQHKPPFTLLDCFL
DKVLKHPEKPFILFEDEIYSYRDIDRRSNQMARVLKDYVRLKEGETLAVFLKNIPAYIWI
WMGLEKIGCTMACINYNIRLKSLLHVLRTCNAKVLLTTPDLKNSIEDVLPVLKDEGVQVF
YLSDNSPSDGVEALLGQVKLTSEEPVPASYRAHITAKSTSVYIFTSGTTGLPKAAIINQM
KLLMISNIFTLCDVNAKDIIYIPLPLYHSAGLLIGIGGCLEVGATCVLGPKFSVSNFWND
CRRYQVSVIQYVGETMRYLCNAPKKDNDRDHRVKLAIGNGMKREVWKEFLCRFGCLKVYE
FYGATEGNLGFINYTGKVGAVGRINFLYKKLTKFEIIQYDVDQNEVVRNEKGYCVPVAPG
ETGLLVAKITKRTPFYGYAGDPEKTKKKLLHDVLEKGDSYFNSGDLLMQDHDGFIYFQDR
VGDTFRWKGENVATTEVETILAMLEFTQEVNVYGVPVPGHEGKIGMAAIRLKEGGSFDGK
QLYEHTKNYLPNYAIPHFIRIQEALEITGTFKQRKNQLVKEEFDPITITEPLFFLDNSEK
SFVPLTLQIYHSITEKKRKL
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgcttgacttttatacaattttgctggggatcttgtttcttctccctctgctggccaat
atttttttcccttatctttggctggacctgcgcttctttttctctctcttgcggacagga
tacaagtcccaaaagcgtttacagcataagccaccattcaccctcttggactgtttttta
gacaaggtcctgaaacatccagagaagcctttcattctctttgaagatgaaatttattcc
tatcgggacattgacagacgtagcaaccaaatggccagagtactgaaggactatgtgagg
ctgaaagaaggggaaacgctggctgttttcttgaagaatatccctgcctatatctggatc
tggatgggcttggagaagattggctgcaccatggcatgcatcaattataacatccgatta
aaatctttgttgcatgtattgagaacctgcaatgccaaagtgcttctgacaactccagat
ttaaaaaattccattgaagatgttctacctgttttaaaggatgaaggggtacaagttttc
tatctcagtgacaattccccctccgatggtgtggaagcgctacttggacaggttaaattg
acctcagaggaacctgtgcctgcttcctacagagcccatataacagctaaatctacatct
gtgtacatttttacctctgggaccacaggattaccaaaagctgctatcatcaaccaaatg
aagttgctcatgatatccaacatattcactttgtgtgacgtcaatgccaaggacatcatc
tacattccgctgccactgtaccattcagctgggcttcttattggaattggagggtgcctg
gaggttggagctacatgtgttttagggccgaagttttctgtttcaaatttctggaatgac
tgcaggcgatatcaggtttctgtaatccaatatgtgggagaaacaatgcgctatttatgt
aatgcaccaaagaaggacaatgatcgtgatcatagagtgaaactggccataggcaatggc
atgaagagagaggtctggaaagaatttctgtgccgattcggatgccttaaggtttatgaa
ttctatggagctacagaaggcaatcttggctttattaactacactgggaaagttggagct
gtaggaaggattaacttcctttataagaaactgacaaaatttgaaataattcaatatgat
gttgaccagaatgaggttgtgaggaatgaaaaaggatactgtgtcccggtggccccaggc
gaaacaggtttactagtagccaagatcaccaagaggactcccttctatggctatgcagga
gatcctgagaaaacaaaaaagaagcttctccatgatgtcctagagaaaggagacagctac
tttaacagtggtgacctcttgatgcaagaccacgatggatttatatatttccaggaccga
gtgggagatactttccgttggaaaggagagaatgtggctactacagaagttgagacaatc
cttgctatgctggaatttactcaagaagtaaatgtatatggagtacctgtgccagggcac
gaaggaaagattgggatggcagcaatacgattaaaggaagggggatcctttgatggaaag
cagttatatgaacataccaagaattacttgccaaactatgctatacctcactttattcgc
atccaggaggccttagagatcacagggactttcaagcagcgcaaaaatcagttggtgaag
gaagaatttgaccctatcaccatcacagaacccctatttttcttggacaattcagaaaag
agctttgtgccactgactctgcagatctaccattccatcacagagaagaagcggaaactc
tga

KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107282428Help
Entry
107282428         CDS       T05763                                 

Definition
(RefSeq) very long-chain acyl-CoA synthetase isoform X1
  KO
K08746  solute carrier family 27 (fatty acid transporter), member 2 [EC:6.2.1.- 6.2.1.3]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur03320  PPAR signaling pathway
pmur04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107282428
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    107282428
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pmur01004]
    107282428
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pmur02000]
    107282428
Enzymes [BR:pmur01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     107282428
    6.2.1.-  
     107282428
Lipid biosynthesis proteins [BR:pmur01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   107282428
Transporters [BR:pmur02000]
 Solute carrier family (SLC)
  SLC27: Fatty acid transporter
   107282428
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C Sigma70_r1_1
Motif
Other DBs
NCBI-GeneID: 107282428
NCBI-ProteinID: XP_015665692
Position
Unknown
AA seq 619 aa AA seqDB search
MLDLYTAVFGLLILLPLLGKYFFPYFWLDLKNIIACIHMGYQCHSYMQRTAPFTVLEIFL
ARVKKYSDKSLIIFEDEVYSYRDIDRHSNQIARVLKDYVGLKEEETMAIFFKNIPAYLSV
LIGLSKIGCPMACVNYNLRLKSLIHVLKSCKAKILLTTPDLKDAIEDVLPTLNDEGIRVF
YLSDDSPTEGVEALLKRIKLSSAESVPFSLRAHVTPKSTCLYIFTSGTTGLPKAAVISQK
KALMGSYLFYLTGVHNKDVIYTPLPLYHSAGILGLLGTIKVGATCVLRSKFSVSHYWDDC
RRYRVTVIQYVGELMRYLCNAPKRDNDRDHRVRAAIGNGLRTEIWNEFLNRFGPIKIYEV
YGATEGIAGFINYVGKVGAVGKTNFFIKKLFNYKLVQYDVDADQPVRDEKGFCIPVATGQ
GGLMVIQISKALPFEGYAGDYKNTEKKILRNVQKKGDSYFNTGDLLMEDHEGFIYFKDRV
GDSFRWKGENVATTEVEMTLASLDITEEVNVYGVPVPGHEGKIGMAAMRLKDGCPFDGKK
LFIHTKDYLPSYAIPRFIRIQEKLEITGTFKQRKGQLVKDGFNPANINDPFFFLDDSEKN
YIPMTEEIYCSILEKKRKL
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgctggatctatacacagctgtgtttgggcttttgattcttctgcccctgctgggcaaa
tatttcttcccctatttttggttagatctgaaaaacattattgcctgcatacacatggga
tatcaatgccacagttacatgcagcgcactgcccctttcactgtattagaaatatttttg
gccagagttaagaagtattcagacaaatccttgattatctttgaagatgaggtttattcc
taccgagacattgatagacacagcaaccagatagccagagtactgaaggactatgtgggg
ctgaaagaagaggagaccatggctattttcttcaaaaacattcctgcctatctctcagtt
ttgattggcttatcaaagattggctgtcccatggcatgtgtcaactataatttacgactc
aaatctctgatacatgtgctgaagtcttgcaaggctaaaattcttctaacaactccagat
ttaaaagatgccattgaagatgtcctgcctactttaaatgatgaagggatacgtgttttc
tatctgagtgatgattccccaactgaaggtgtagaggcactgctcaaacggatcaaatta
agctctgctgaatcagtgcccttttccctcagagcccatgtaacccctaaatctacatgc
ctatatattttcacctctggtaccacaggactccccaaagctgctgtcatttcccagaag
aaagcattaatggggtcgtacctgttttacttgaccggtgtccataacaaggatgttatt
tatactccactcccactgtatcactcagctggaatccttgggcttctggggaccataaaa
gtgggggctacatgtgttctgagatctaagttctctgtttctcattactgggatgactgc
aggcgttaccgtgtcactgtgatccagtatgtaggagaactgatgcgctacttgtgtaat
gcaccaaagagagacaatgaccgtgaccatagggtgcgagcagccattggcaatggatta
cgaacagagatttggaatgagttcctgaatcgatttggacccatcaaaatctacgaagtt
tatggagctactgaaggaattgctggattcattaattatgtaggaaaagttggagcagtg
ggaaagaccaatttcttcattaagaaactatttaactataaacttgtgcaatatgatgtg
gatgcagatcagcctgtgagagatgagaaggggttctgtatcccagtagctacaggacag
ggaggtttaatggtaatacagataagtaaggcactcccgtttgaaggttatgcaggagat
tataaaaacacagagaagaaaattctccgtaatgtgcagaagaaaggagacagttatttt
aatactggagatcttttgatggaagaccatgaaggttttatctatttcaaggatcgtgta
ggagattctttccgctggaaaggggagaacgtggccactactgaggttgagatgacattg
gcaagtttggatatcactgaggaagtcaatgtatatggagtaccagtgccagggcatgaa
ggaaagattgggatggcagccatgcggctgaaggatgggtgcccctttgatggaaagaag
ttgttcatacataccaaggattatctgcccagctacgccataccccgcttcatccgtatc
caggagaagctagagatcacaggaactttcaagcagcgcaaaggtcagttggtgaaggat
ggattcaatcctgccaacatcaacgatcccttcttcttcctggatgactcagaaaagaac
tacatacccatgactgaggagatctactgctccattttagaaaagaaaagaaaactctga

KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107282429Help
Entry
107282429         CDS       T05763                                 

Definition
(RefSeq) very long-chain acyl-CoA synthetase-like isoform X1
  KO
K08746  solute carrier family 27 (fatty acid transporter), member 2 [EC:6.2.1.- 6.2.1.3]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur03320  PPAR signaling pathway
pmur04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107282429
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    107282429
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pmur01004]
    107282429
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pmur02000]
    107282429
Enzymes [BR:pmur01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     107282429
    6.2.1.-  
     107282429
Lipid biosynthesis proteins [BR:pmur01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   107282429
Transporters [BR:pmur02000]
 Solute carrier family (SLC)
  SLC27: Fatty acid transporter
   107282429
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C Sigma70_r1_1
Motif
Other DBs
NCBI-GeneID: 107282429
NCBI-ProteinID: XP_015665693
Position
Unknown
AA seq 619 aa AA seqDB search
MLDLYTAVFGLLILLPLLGKYFFPYFWLDLKNIIACIHMGYQCHSYMQRTAPFTVLEIFL
ARVKKYSDKPLIIFEDEVYSYRDIDRHSNQIARVLKDYVGLKEEETMAIFFKNIPAYLSV
LIGLSKIGCPMACVNYNLRLKSLIHVLKSCKAKILLTTPDLKDAIEDVLPTLNDEGIRVF
YLSDDSPTEGVEALLKRIKLSSAESVPFSLRAHVTPKSTCLYIFTSGTTGLPKAAVISQK
KALMGSYLFYLTGVHNKDVIYTPLPLYHSAGLFGLLGTIKVGATCVLRSKFSVSHYWDDC
RRYRVTVIQYVGELMRYLCNAPKRDNDRDHRVRAAIGNGLRTEIWNEFLNRFGPIKIYEV
YGATEGTGGFINYVGKVGAVGKTNFFIKKLFNYKLVQYDVDADQPVRDEKGFCIPVPTGQ
GGLMVIQISKALPFEGYAGDYRNTENKILPNVLKKGDSYFNTGDLLMEDHEGFIYFQDRV
GDSFRWKGENVATTEVEMTLASLDIIEEVSVYGVPVPGHEGKIGMAAMRLKDGCPFDGKK
LFIHTKDYLPSYAIPRFIRIQEKLEITGTFKQRKGQLVKDGFNPANINDPFFLLDDSEKN
YIPMTEEIYCSILEKKRKL
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgctggatctatacacagctgtgtttgggcttttgattcttctgcccctgctgggcaaa
tatttcttcccctatttttggttagatctgaaaaacattattgcctgcatacacatggga
tatcaatgccacagttacatgcagcgcactgcccctttcactgtattagaaatatttttg
gccagagttaagaagtattcagacaaacccttgattatctttgaagatgaggtttattcc
taccgagacattgatagacacagcaaccagatagccagagtactgaaggactatgtgggg
ctgaaagaagaggagaccatggctattttcttcaaaaacattcctgcctatctctcagtt
ttgattggcttatcaaagattggctgtcccatggcatgtgtcaactataatttacgactc
aaatctctgatacatgtgctgaagtcttgcaaggctaaaattcttctaacaactccagat
ttaaaagatgccattgaagatgtcctgcctactttaaatgatgaagggatacgtgttttc
tatctgagtgatgattccccaactgaaggtgtagaggcactgctcaaacgaatcaaatta
agctctgctgaatcagtgcccttttccctcagagcccatgtaacccctaaatctacatgc
ctatatattttcacctctggtaccacaggactccccaaagctgctgtcatttcccagaag
aaagcattaatggggtcgtacctgttttacttgaccggtgtccataacaaggatgttatt
tatactccactcccactgtaccactcagctggactctttgggcttctggggaccataaaa
gtgggggctacatgtgttctgagatctaagttctctgtttctcattactgggatgactgc
aggcgttaccgtgtcactgtgatccagtatgtaggagaactgatgcgctacttgtgtaat
gcaccaaagagagacaatgaccgtgaccatagggtgcgagcagccattggcaatggatta
cgaacagagatttggaatgagttcctgaatcgatttggacccatcaaaatctacgaagtt
tatggagctactgaaggaactggtggattcattaattatgtaggaaaagttggagcagtg
ggaaagaccaatttcttcattaagaaactatttaactataaacttgtgcaatatgatgtg
gatgcagatcagcctgtgagagatgagaaggggttctgtatcccagtgcctacaggacag
ggaggtttaatggtaatacagataagtaaggcactcccgtttgaaggttatgcaggagat
tatcgaaacacagagaataaaattctccctaatgtgctaaagaaaggagacagttatttt
aatactggagatcttttgatggaagaccatgaaggttttatctatttccaggatcgtgtg
ggagattcttttcgctggaaaggggagaacgtggccactactgaggttgagatgacattg
gcaagtttggatatcattgaggaagtcagtgtatatggagtaccagtgccagggcatgaa
ggaaaaattgggatggcagccatgcggctgaaggatgggtgcccctttgatggaaagaag
ttgttcatacataccaaggattatctgcccagctacgccataccccgcttcatccgtatc
caggagaagctggagatcacaggaactttcaagcagcgcaaaggtcagttggtgaaggat
ggattcaatcctgccaacatcaacgatcccttcttcctcctggatgactcagaaaagaac
tacatacctatgactgaggagatctactgctccattttagaaaagaaaagaaaactctga

KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107299483Help
Entry
107299483         CDS       T05763                                 

Definition
(RefSeq) very long-chain acyl-CoA synthetase-like
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 107299483
NCBI-ProteinID: XP_015684324
Position
Unknown
AA seq 134 aa AA seqDB search
WKGENVATTEVADILGLINFVQEVNVYGVSVPGHEGRIGMASLRLAESCDFGGEILYKHA
TDYLPLYARPYFVRIQDAIEITGTFKYRKIQLAEEGFNPAVVKDALYFLDDKEKTYIPLT
EDIYNSICSNRWKL
NT seq 406 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaggagaaaacgtggctacgacagaagttgccgatattttaggtctgatcaactt
tgttcaggaggtgaatgtgtatggtgtatctgtgccaggtcacgaaggccggataggcat
ggcatccctacgactagcagaaagttgtgattttggtggagaaattctctacaagcatgc
aacagattacttgccactttatgcaagaccgtatttcgtgaggatccaggatgctattga
gatcacgggaacatttaaataccggaaaatacagttagcagaagaaggattcaatccagc
agttgtcaaggacgccttatattttttggatgataaagagaagacctacatacccttgac
agaagacatatataactcaatatgtagcaacagatggaaactatag

KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107302507Help
Entry
107302507         CDS       T05763                                 

Gene name
SLC27A2
Definition
(RefSeq) LOW QUALITY PROTEIN: very long-chain acyl-CoA synthetase
  KO
K08746  solute carrier family 27 (fatty acid transporter), member 2 [EC:6.2.1.- 6.2.1.3]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur03320  PPAR signaling pathway
pmur04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107302507 (SLC27A2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    107302507 (SLC27A2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pmur01004]
    107302507 (SLC27A2)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pmur02000]
    107302507 (SLC27A2)
Enzymes [BR:pmur01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     107302507 (SLC27A2)
    6.2.1.-  
     107302507 (SLC27A2)
Lipid biosynthesis proteins [BR:pmur01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   107302507 (SLC27A2)
Transporters [BR:pmur02000]
 Solute carrier family (SLC)
  SLC27: Fatty acid transporter
   107302507 (SLC27A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding HTH_5
Motif
Other DBs
NCBI-GeneID: 107302507
NCBI-ProteinID: XP_029143072
Position
Unknown
AA seq 622 aa AA seqDB search
MFSGLWTALAGLLLLPLLARLACPYFFQDLCFFLKLLAVGRRARQGAMRRPPRTLLEVFG
QQARRAPEKPLLLFRDEVYTYRQVERRSNQVARALREQAGLRQGDCLALYLANQPAYLWI
WLGCAKLGCALACLNCNVRGRPLVHSFQASGAKVLLADPDFKGTIEDVLPTLKQENVLVY
FLSRTSDTEGVDSFLDKMEAASDEAVPESWRSDITCKSPAMYIYTSGTTGLPKAAVITHL
RVLLGCGLIMLSGVTSEDIIYTTLPLYHSSALLLGVNGCIMQGATLVLRSKFSASQFWDD
CRKYKVTVIQYIGEVLRYXCXSPQKDNDQNHVVRLAIGNGLRPDIWREVIRRFGDIRIFE
FYAATEANVGFVNYSGKVGAVGRSNYFHKKMIQYNLIKYDVEKDEPVRDENGYCIKVPKG
EVGLLICKITQLAPFSGYAGSKSLTEKKKLRNVFQNGDVYFNSGDLLMIDRDNFIYFHDR
VGDTFRFVSFSLPTPPPGVAHWVGVVHWLREVNIKGNSPAGHEGRIGMASLRLAESCDFG
GEILYKHATDYLPLYARPYFVRIQDAIEITGTFKYRKIQLAEEGFNPAVVKDALYFLDDK
EKTYIPLTEDIYNSICSNRWKL
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgttctcgggcctctggacggcgctggcggggctcctgctcctgccgctgctggccagg
ctggcgtgcccctatttcttccaggacttgtgcttcttcttgaagctgctggccgtgggg
cggcgggccaggcaaggcgcgatgcggcgccccccgcgcaccttgctggaggtgttcggg
cagcaggcgcgccgggcgcccgagaagccgctgctgctcttccgagacgaggtctacacc
tatcggcaggtggagaggcgcagcaaccaggtggcgcgggctctgcgggagcaggccggg
ctccggcagggcgactgcctggccctttacctggccaaccagcccgcctacctctggatc
tggctgggctgcgccaagctgggctgcgccctggcctgcctcaactgcaacgtccgagga
cggccgctggtgcacagcttccaagctagtggggccaaggtcttgctggccgacccagac
ttcaaagggaccattgaagacgtattgccaaccctgaagcaagaaaatgtgcttgtttat
ttcttaagtagaacgtctgacactgaaggggttgacagtttccttgacaagatggaagct
gcttcagatgaggctgttccagaatcttggagatcagatattacttgcaaaagccccgcc
atgtacatttatacctctggaactacaggtctccccaaagctgcagtgattactcatctc
cgtgtattattgggttgtggtttgatcatgctcagtggtgtcacttcagaggacattatt
tacaccaccctgccattatatcacagctctgccctcttgcttggagtaaatggttgcatc
atgcaaggtgctaccctagtattacgctcaaaattctctgcttctcagttttgggatgat
tgtagaaaatacaaggtgactgtcatacagtacattggagaggtgctacgttatngatgt
tgaagtccacaaaaagacaatgatcagaaccacgtggtaagacttgctataggcaatggc
ttacggcctgatatttggagggaagtcatcagaagatttggagacatacgtatctttgag
ttttatgcagccaccgaagccaacgtcggatttgttaactacagtggaaaagtcggagct
gtggggagatcgaattacttccacaagaaaatgatacaatacaacctcattaagtatgat
gtggagaaagatgaaccggtcagagatgaaaatggctactgtataaaagttcctaaaggt
gaagtgggactgttgatttgcaaaatcacccagttggctccatttagtggttacgcggga
tcaaagagcctgacggaaaagaagaagctaagaaatgttttccagaatggtgacgtgtat
ttcaacagcggagatcttttaatgattgatcgtgacaactttatttatttccacgatcga
gttggagatacattccggtttgtttctttctctctccccaccccaccccccggcgtggcc
cattgggtgggggtggtccattggttgagagaagtcaatattaagggtaattctcctgca
ggtcacgaaggccggataggcatggcatccctacgactagcagaaagttgtgattttggt
ggagaaattctctacaagcatgcaacagattacttgccactttatgcaagaccgtatttc
gtgaggatccaggatgctattgagatcacgggaacatttaaataccggaaaatacagtta
gcagaagaaggattcaatccagcagttgtcaaggacgccttatattttttggatgataaa
gagaagacctacatacccttgacagaagacatctataactcaatatgtagcaacagatgg
aaactatag

DBGET integrated database retrieval system