KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107283290Help
Entry
107283290         CDS       T05763                                 

Gene name
ALDH7A1
Definition
(RefSeq) alpha-aminoadipic semialdehyde dehydrogenase
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur00010  Glycolysis / Gluconeogenesis
pmur00053  Ascorbate and aldarate metabolism
pmur00071  Fatty acid degradation
pmur00260  Glycine, serine and threonine metabolism
pmur00280  Valine, leucine and isoleucine degradation
pmur00310  Lysine degradation
pmur00330  Arginine and proline metabolism
pmur00340  Histidine metabolism
pmur00380  Tryptophan metabolism
pmur00410  beta-Alanine metabolism
pmur00561  Glycerolipid metabolism
pmur00620  Pyruvate metabolism
pmur01100  Metabolic pathways
Module
pmur_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
pmur_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107283290 (ALDH7A1)
   00053 Ascorbate and aldarate metabolism
    107283290 (ALDH7A1)
   00620 Pyruvate metabolism
    107283290 (ALDH7A1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107283290 (ALDH7A1)
   00561 Glycerolipid metabolism
    107283290 (ALDH7A1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    107283290 (ALDH7A1)
   00280 Valine, leucine and isoleucine degradation
    107283290 (ALDH7A1)
   00310 Lysine degradation
    107283290 (ALDH7A1)
   00330 Arginine and proline metabolism
    107283290 (ALDH7A1)
   00340 Histidine metabolism
    107283290 (ALDH7A1)
   00380 Tryptophan metabolism
    107283290 (ALDH7A1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107283290 (ALDH7A1)
Enzymes [BR:pmur01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     107283290 (ALDH7A1)
    1.2.1.8  betaine-aldehyde dehydrogenase
     107283290 (ALDH7A1)
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     107283290 (ALDH7A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-GeneID: 107283290
NCBI-ProteinID: XP_015666655
Position
Unknown
AA seq 543 aa AA seqDB search
MLLQVGLSGLARRALLRKSVSFAASCNRPAAFMSTLLINQAQYAWLKELGLREENEGVYN
GSWGGRGEVVTTYCPANNQPIAKVRQANLEDYEETIKKAKEAWQIWAEVPAPKRGEIVRQ
IGDALRDKIKILGNLVSLEMGKIFVEGVGEVQEYVDICDYAVGLSRMFGGPVLPSERPGH
ALIEQWNPLGLVGIITAFNFPVAVYGWNNAIALICGNVCLWKGAPTTSLTSVAVTKIIAQ
VLEKNKLPGAICSLACGGADIGTAMARDEQIDLLSFTGSTNVGKQVAVTVQERFGRCLLE
LGGNNAIIVFEDADLNLVIPSALFAAVGTAGQRCTTARRLFLHESIHDQVVEKLMKAYAQ
VRIGDPWDANTLYGPLHTKQAVKMFLDAVEVAKQQGGSVVYGGKVIERPGNYVEPTIVIG
LPHNSPIVHTETFAPILYVLKFKTEEEAFGWNNSVKQGLSSSIFTKDLGRIFRWLGPKGS
DCGIVNINIPTSGAEIGGAFGGNKHTGGGRESGSDSWKQYMRRSTCTINYSKDLPLAQGI
KFH
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgcaagttggactttcggggctcgccaggcgtgctctgctaaggaagagcgtc
tccttcgccgcttcttgcaacagaccggccgccttcatgtcgaccttgctgatcaaccaa
gcccagtacgcctggctgaaagaattggggcttcgagaagaaaacgagggcgtttacaat
ggctcctggggaggaagaggagaggttgtgactacatactgtcctgcaaataatcagccc
atagctaaagttcgccaggcaaatttggaagactatgaagaaacaataaagaaagctaaa
gaagcttggcaaatatgggcagaggttcctgcacctaaacgaggagaaatagtgagacag
attggagacgccttaagagacaaaatcaaaattttgggaaatttagtatcattagaaatg
gggaagatctttgttgaaggtgttggtgaagtccaggaatatgtagatatctgtgattat
gctgttggtttatctcgaatgtttggtggacccgtgctgccttcagaaagacctggacat
gccttaatagaacaatggaaccctttgggattagttggcatcatcacagcctttaatttc
cctgttgcagtttatggatggaacaatgcaattgcactcatctgtggcaatgtctgcttg
tggaaaggtgcacccacgacatccctcaccagtgtggctgttacaaaaataattgcacaa
gtcctagagaagaacaagctgcctggtgctatttgctctctggcttgtggtggagcagat
attggcacagcaatggcaagagatgagcaaattgatctgctctccttcactggcagcacc
aatgtgggcaagcaagtagctgtgacagtccaggagagatttggacgatgcctgttggag
cttggtggaaacaacgctattattgtatttgaagatgcagatctcaacctagtcattcca
tctgccctctttgcagctgtgggtacagcaggccagagatgcacaactgctaggaggctg
tttttgcatgaaagcatccatgatcaagtggtagaaaaactcatgaaggcatatgctcaa
gtccgtattggagatccatgggatgcaaacaccctgtacggtcctcttcatacaaagcaa
gcagttaagatgttccttgatgcagtggaagtggccaaacaacaaggtggctctgttgtc
tatggtgggaaggttatagaacgtcctggaaactatgttgaaccaaccattgtgattggc
cttcctcataattctccaattgtgcacacagagacatttgctcctattctctatgtgctc
aaatttaagacagaggaagaagcttttggttggaacaatagtgtgaaacaaggcttgtcc
agcagcatcttcactaaggatttgggcagaatattccgatggctagggcccaaggggtca
gactgtggaatcgttaatatcaatatccctaccagtggagctgaaattggaggtgcattc
ggaggtaataaacacacgggtggtggaagagaatctggtagtgattcatggaagcagtat
atgaggcgatccacttgcacaattaattacagcaaagatttgcctcttgctcaaggaatc
aaatttcattaa

DBGET integrated database retrieval system