KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107283717Help
Entry
107283717         CDS       T05763                                 

Gene name
PPIE
Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase E
  KO
K09564  peptidyl-prolyl isomerase E (cyclophilin E) [EC:5.2.1.8]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    107283717 (PPIE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pmur03041]
    107283717 (PPIE)
   03110 Chaperones and folding catalysts [BR:pmur03110]
    107283717 (PPIE)
Enzymes [BR:pmur01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     107283717 (PPIE)
Spliceosome [BR:pmur03041]
 Complex B
  Other components
   Prp19-related factors
    107283717 (PPIE)
 Complex C
    107283717 (PPIE)
Chaperones and folding catalysts [BR:pmur03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    107283717 (PPIE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase RRM_1 RRM_5 RRM_7 DUF4944 RRM_occluded
Motif
Other DBs
NCBI-GeneID: 107283717
NCBI-ProteinID: XP_015667138
Position
Unknown
AA seq 301 aa AA seqDB search
MASSKRVLYVGGLAEEVDERVLHAAFIPFGDLTDIQIPLDYETEKHRGFAFIEFELAEDA
AAAIDNMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDDWLKKFSGKTLQENLEEEGAV
AARSEVQEGEPPVKKSRTNPQVYMEIKIGNKPAGRLHILLRSDIVPMTTENFRCLCTHEE
GFGFKGSSFHRIIPQFMCQAGDFTNHNGSGGKSIYGKKFDDENFILKHTGPGLLSMANSG
PNTNGSQFFITCDKTDWLDGKHVVFGEVTEGMDVVRQIEAQGGKDGKPKQKVIISDCGEF
I
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggcctccagcaagcgggttctctacgtgggtgggctggccgaggaggtggacgaacgg
gtgctgcacgcggccttcatccccttcggagaccttaccgacatccagatcccgctggac
tacgagaccgaaaaacaccgaggcttcgctttcattgaatttgagctggctgaggatgct
gcagctgctattgacaacatgaacgaatctgagctctttgggaggactatccgtgtcaac
ctggccaagccaatgaggatcaaagaaggctcctcccgtccagtctggtcggatgatgac
tggctgaagaaattttcgggaaagacacttcaggagaatttggaagaagagggagcggtg
gcagcccggtcagaggttcaagagggagaaccaccagtgaaaaaatccaggaccaacccc
caggtttacatggagatcaagattggaaataaacctgcaggtcgattgcatattctcttg
cggtcagatattgtcccgatgactactgagaacttccgctgcctttgcacacacgaggaa
ggcttcggctttaagggaagcagctttcaccgaattatcccccagttcatgtgccaggct
ggagatttcaccaaccacaacggcagcggcgggaagtcgatctacgggaagaagtttgat
gatgagaactttatcctgaagcacacggggccaggtttgctgtccatggccaattctggt
cccaacaccaatggctcccagttttttatcacttgcgacaagactgactggctggacggg
aagcacgtggtcttcggagaggttaccgaagggatggacgtggtgcggcaaattgaggct
caaggcggcaaagatgggaaaccaaagcaaaaagtcatcatctctgattgtggtgaattc
atctga

DBGET integrated database retrieval system