KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107283925Help
Entry
107283925         CDS       T05763                                 

Gene name
IDH2
Definition
(RefSeq) isocitrate dehydrogenase [NADP], mitochondrial
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur00020  Citrate cycle (TCA cycle)
pmur00480  Glutathione metabolism
pmur01100  Metabolic pathways
pmur01200  Carbon metabolism
pmur01210  2-Oxocarboxylic acid metabolism
pmur01230  Biosynthesis of amino acids
pmur04146  Peroxisome
Module
pmur_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pmur_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    107283925 (IDH2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107283925 (IDH2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107283925 (IDH2)
Enzymes [BR:pmur01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     107283925 (IDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 107283925
NCBI-ProteinID: XP_015667390
Position
Unknown
AA seq 453 aa AA seqDB search
MARYLRSGAAVAAAAAAWPRCPAAALPVLSAWPRPPHRHYADQRIKVANPVVEMDGDEMT
RIIWAFIKEKLILPNVDVQLKYFDLGLPHRDQTEDQVTIDSALATQKYSVAVKCATITPD
EGRVEEFKLKKMWKSPNGTIRNILGGTVFREPIVCKNIPRLVPGWTKPITIGRHAHGDQY
KATDFVVDKSGTFKMVFVPKDGSGAKEWEVFNFPGGGVGLGMYNTDESISGFAHSCFQYA
IQKKWPLYMSTKNTILKAYDGRFKDIFQEVFDKHYKTDFDKLKIWYEHRLIDDMVAQVLK
SAGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHFREHQ
KGRPTSTNPIASIFAWTRGLQHRGKLDSNPQLVKFAETLERVCVETVESGTMTKDLAGCI
HGLSNVKLNEHFVNTTDFLDAIKSNLDRALSKQ
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggcacgctacctccgctctggggccgccgtcgccgccgccgccgccgcctggcctcgc
tgcccggccgctgcgctccccgtgctcagcgcttggcctcgcccgccccaccggcactat
gctgaccagagaatcaaggttgccaaccctgtggtggaaatggacggggatgagatgacc
cggatcatctgggccttcatcaaggaaaagctgatcttgcccaacgtggacgtgcagctg
aagtactttgacctgggactgccccaccgggaccagacggaggaccaagtcaccatcgac
tcggccctggccacccagaagtacagcgtggctgtgaagtgcgccaccatcacccccgat
gagggccgtgtggaagaattcaagctgaagaagatgtggaagagccccaacggtaccatc
cggaacatcctgggtgggacggttttccgagagcccatcgtctgcaagaacatccctcgc
ctggtcccaggctggacgaagcccatcaccattgggagacatgcccacggtgaccagtac
aaagccacggactttgtggtggataaatcagggaccttcaagatggttttcgtgcccaaa
gatggcagtggagccaaggagtgggaagtctttaacttcccaggcgggggtgtcggcctg
ggcatgtacaacacggatgagtccatctcgggctttgcccacagctgcttccagtacgcc
atccagaagaaatggccgctctacatgagtaccaagaacaccatcctcaaggcctacgat
gggcggttcaaggatatcttccaggaagtctttgataagcactacaagaccgactttgac
aagctcaagatctggtacgagcacaggctcattgatgacatggtggcccaggtgctgaaa
tcagctggcggcttcgtctgggcctgcaagaactacgatggagatgtccaatcggacatc
ctggcccaagggtttggctccctgggacttatgacctcggttctcgtctgtccggatgga
aaaaccatcgaagcagaggctgctcacggcacggtgactcgccacttccgggagcaccag
aagggccgtcccactagcaccaaccccattgccagcatcttcgcctggaccagaggcctg
cagcatcgaggcaagctggacagcaacccacagctggtcaagtttgccgagactctggag
agggtctgcgtggagacggtggagagcgggacaatgacaaaggatctggctggctgcatc
catggattaagcaatgtaaagttaaacgagcactttgtgaacaccactgacttcctggac
gccatcaagagcaacctggatagagccctgagcaagcagtag

DBGET integrated database retrieval system