KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107284221Help
Entry
107284221         CDS       T05763                                 

Gene name
HCFC1
Definition
(RefSeq) host cell factor 1
  KO
K14966  host cell factor
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107284221 (HCFC1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pmur01009]
    107284221 (HCFC1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pmur03036]
    107284221 (HCFC1)
   03029 Mitochondrial biogenesis [BR:pmur03029]
    107284221 (HCFC1)
Protein phosphatases and associated proteins [BR:pmur01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107284221 (HCFC1)
Chromosome and associated proteins [BR:pmur03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    NSL complex
     107284221 (HCFC1)
   HMT complexes
    COMPASS/SET1 complex
     107284221 (HCFC1)
    MLL-HCF complex
     107284221 (HCFC1)
Mitochondrial biogenesis [BR:pmur03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    107284221 (HCFC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kelch_5 Kelch_3 Kelch_1 Kelch_4 Kelch_6 Kelch_2 fn3 ANAPC_CDC26
Motif
Other DBs
NCBI-GeneID: 107284221
NCBI-ProteinID: XP_029139230
Position
Unknown
AA seq 2194 aa AA seqDB search
MASPVVPSGGSPTGGGATAGLLQPRWKRVIGWSGPVPRPRHGHRAVAIKELIVVFGGGNE
GIVDELHVYNTATNQWFIPAVRGDIPPGCAAYGFVCDGTRLLVFGGMVEYGKYSNDLYEL
QASRWEWKRLKAKTPKNGSTPCPRLGHSFSLVGNKCYLFGGLANDSEDPKNNIPRYLNDL
YILELRPGSGVGSWDIPITYGVLPPPRESHTAVVYTEKDNKKSKLVIYGGMSGCRLGDLW
TLDIDSLTWNKPNLRGVAPLPRSLHSATTIGNKMYVFGGWVPLVMDDVKVATHEKEWKCT
NTLACLNLDSMAWEPILMDTLEENTPRARAGHCAVAINTRLYIWSGRDGYRKAWNNQVCC
KDLWYLETEKPPPPSRVQLVRANTNSLEVSWGSVPTADTYLLQLQKYDIPAASSPAANPV
PSVPVNPPKSPAPAAAAPVSAVQPLAQMGITLLPQTTAVAAATAAAAAAAAAASTPAPPT
TTTIQVLPTVPTSPMPVPPVAAAVATPRPQTVPAVLKVTGPQATTGAPLVTVRSAGQAGK
GPMTVTSLPAGVRMVVPTQSTQGTVIGSSSQMSGMAALAAAAAATQKIPPSSAPTMLSMP
AGTTIVKTVAVSPGTTTLPTTVKVASPVMVSNPATRMLKTAAAQVGTSVSSSTTNTPTRP
IITVHKSGTVTVAQQAQVMTTVVGGVTKTITLVKSPISMPGGSALISNLGKVMSVMQTKP
VQSSAVTGQASTGPVTQIIQTKGPLPAGTILKLVTSADGKPTTIITSSQAGGTGTKPTIL
GISSVSPNTTKPGTTTIIKTIPMSAIMTQSGATGVTSSPGIKSPIAIITTKVMTSGTGTP
AKIITASLPKLATSHGQQSVTQVVLKGAPGQPGTILRTVPMGGVRLVTPVTVSAVKPTVT
TLVVKGTTGVTTLGTVTGTMSTSLAGTGAHNTNASLATPITTLGTIATLSSQVINPAAIT
VSAAQTTLTAAGGLTTPTITMQPVSQPTQVTLITTPSGVEAQPVHDLPVSILASPTTEQP
TATVTIAESGQGDPQPGTVTLVCSNPPCETHETGTTNTATTTVVGSLGGPAQLQFVCDGQ
EGGGLQPNGRVVRVCSNPPCEMHETGTTNTATIVLSAGQKICSNPPCETHETGTTNTATI
SKTEKAPAEPPCQTFQTNATGTTMTVKPIVGTGQLVCSNPPRETHETGTTNTATTTTSNM
GQGQPDDGQKEPANTSCQTKQTGSTSTTMTTKTDIPTEHPCAVQIVSFVPAAGLPSVASG
TTTVQSGERLQAPKKKQCESHHTHTTNTATTARSLMGQGQPDGEWVGSANPPCQTQQTNS
TSTTMSVKVDVPVQSSAPCKTHNTDNKDTNLQVCSNPPCETHETGTTNTATVTTSNLGAT
QRVCSNPPCETHETGTTNTATTATSNIATGQQVCSNPPCETHETGTTNTATTTTSNLGAG
QNESAQHQQPPVTPPCETQQTNSTSTIMTPSIGGDVAQSSSSASAQCGNSEQRKTPERES
PGTAGSLPQSSTPRICSNPPCETHETGTTHTATTVTSSMGANQDQPPATNGQQGEPEIPV
TESPAASSPSAAVVTTVSTTQIRAVTTVTQSTPAPGPSVPNISTLADVPADEAVPPAEAP
DTTSTDSLPAPSEPLQPSIEMQRAVATPEPQGQAQVASIASTGTPPTEGPLGETAPHPEL
VPPTEETPPTPAPPAQEPVAMVVLPQATPAAPPSSEVEQLALPQELMAESQAGTTTLMVT
GLTPEELAVTAAAEAAAQAAATEEAQALAIQAVLQAAQQAVMGPGEAMDTSEAAATQAEL
GHLSSEGPEGQPTAIPIVLTQQDLAALVQQQQQQLQEAQAAAAAAAAAVQQQQQQQQQQQ
QQPPQHQLPAHLPTEALAPADSLNDPASESNGLNELASAVTSTVGLLPPTPTESLAPSNT
FVAPQPVVVASPAKLQAAAALTEVANGIEPAPVKPEPPTQLPKVIVKKENQWFDVGIVKA
TNMVVTHYFLPPDDAPATDDDSGTTPDYSQFKKQELQPGTAYKFRVAGINACGRGPFSEI
SAFKTCLPGFPGAPCAIKISKSPDGAHLTWEPPSVTSGKITEYSVYLAIQSPQAGEPKTA
APAQLAFMRVYCGPSPSCLVQSASLSNAHIDYTTKPAIIFRIAARNEKGYGPATQVRWLQ
ESSKDGSMTKPTNKRPLSSSDLKSAPKKPKADGQ
NT seq 6585 nt NT seq  +upstreamnt  +downstreamnt
atggcctctcctgttgtccctagtgggggctccccaacaggtggtggggccactgcaggg
ctgctgcagccccgctggaagcgtgtgattggatggtcaggccctgtgcctcggccccga
catggacacagagctgtggcaatcaaagagctgattgtggtcttcggagggggcaatgag
ggcatcgtggatgagttgcatgtctataatacagctacaaaccagtggtttatcccagct
gtgcgtggagacattccaccaggttgtgctgcatatggttttgtttgtgatgggactcgt
ctcctagtatttggtggaatggttgaatatggcaagtacagcaatgatctgtatgaactg
caggccagccgttgggaatggaagagactcaaggccaagacgcccaaaaatgggtccaca
ccatgtccacgccttggccatagcttctcgttggtgggcaacaaatgttacctttttggt
ggactggccaatgacagtgaagatcctaagaataacattcccaggtacctaaatgacctc
tatatcttggagctgcggccaggatctggtgtggggtcctgggacattcccatcacctat
ggtgtattacctccaccacgagaatcccatactgctgttgtctacacagaaaaagacaac
aaaaaatccaaactggtcatatacggaggcatgagtggttgtcgtcttggtgatctctgg
acactagatatcgattctctaacgtggaacaagcccaacctgagaggggttgcaccactc
cctcgcagtctgcattcagccacaaccattgggaacaaaatgtatgtatttggtggctgg
gtgccccttgttatggatgatgtcaaagtggctacgcatgaaaaggaatggaaatgcaca
aatactctggcctgcctcaacctagactccatggcttgggagcccattctgatggacaca
ctggaagagaatactccacgggcacgtgcagggcattgtgctgtagccattaatacccgc
ttgtacatctggagtggccgtgatggctaccgtaaagcctggaacaaccaggtttgctgc
aaggatctctggtatcttgagactgagaaacctccacccccttcacgggttcagctggtt
cgtgccaacaccaactccttggaagtgagctggggttctgtcccaactgcagatacttac
ttactccagctgcagaaatacgacatcccagctgcctcctcgccagctgctaatcctgtg
ccctcagtgcctgtcaatccccccaagagccctgctcctgctgctgctgcacctgtctct
gccgtgcagcctctggcacaaatgggtatcaccttgctgccacagaccacagctgtcgct
gcagccactgctgctgctgctgccgctgccgcggccgcttctactcctgccccaccaacc
acaacaaccatccaggtgcttcctaccgtgcctaccagcccaatgccggtgcctcctgta
gcagctgctgttgctactcctcgtccacaaactgttccagctgtgctgaaggtcactggc
ccacaagctaccacaggagcaccactggtaacagtacggtcagcgggacaagctgggaaa
ggcccaatgacagtgacttctttgccagctggggtacgcatggtggtacccacacagagc
actcaagggacggtgattggtagcagctcccagatgagtggcatggcagctctggcagct
gctgctgcagccactcagaaaattccaccgtcctcagcccccactatgttaagcatgcct
gctggtactaccatagttaagactgtcgcagtgtccccaggcaccaccacattacccacc
acagttaaagtagcttctccagtcatggtgagcaacccagccacccgcatgctgaagaca
gctgctgcccaggtgggcacctcagtctcttcatccaccactaatacacctacccgaccc
atcatcaccgtgcacaaatcaggcactgtcactgtagcacagcaggcccaggtgatgacg
actgtagtgggtggggtaacaaagaccatcacattggtgaaaagccccatctccatgcct
ggaggcagtgcattgatttccaatttgggaaaagtgatgtctgttatgcagaccaaacca
gtccagtcatcagctgtaacaggccaagcatcaactggtcctgtgactcagataatccag
accaaagggcctctgcctgctggcactattctgaaactagtaacttcagcagatggcaag
cccaccacaatcatcaccagctcacaggcaggtggcacaggtactaagcctaccatcctg
ggcatcagcagtgtgtcacccaacacaacaaagcctggtaccaccactattatcaagacc
atccccatgtcagctattatgacgcaatcaggtgccacaggtgttactagtagtcctggg
attaagtctcccatcgccattatcaccacaaaagtgatgacctctggcactggtaccccc
gccaagatcattacagcatcattacccaaactagccacaagtcatggacagcaaagcgta
acacaggtagtgcttaagggggcaccaggacaacctggcacaatcttgcgaactgtccct
atgggtggagtgcgacttgttacccctgtcactgtgtctgcagtcaagcctactgttacc
actttggtagtgaaaggaacaacaggggttacaaccttaggcactgtaacgggcaccatg
tcaacaagcctagctggaactggggcacacaatactaatgcttccttggctacgcctatt
accaccttggggaccattgccacactttccagccaggtcatcaacccagctgccatcact
gtctcagcagcacagacaaccctgacggcagcaggtggcctcactactcccaccatcact
atgcagcctgtttctcagcctactcaagtcaccctgattacaacccccagcggagtagag
gcccagccagtgcacgatttgcctgtttctatcttggcctctcccaccacagagcagccc
acagccacagtcaccattgctgagtcggggcaaggagatccacagccaggcactgttaca
ctggtgtgctccaatccaccctgtgaaacacacgaaactggcacaaccaacacagctaca
accacagttgtgggcagtttgggtgggccagctcagttacagtttgtgtgtgatgggcag
gagggtggaggcctccagcccaatggtcgagtggtgcgggtatgctccaatcccccttgt
gagatgcatgagactggtaccaccaacaccgcaaccatcgttctgagtgctgggcagaag
atttgttccaatccaccttgtgaaactcatgagactggcaccaccaacacagccaccatc
tccaaaacagagaaagcgcccgcagagccaccatgccaaactttccagacaaatgccact
ggcaccactatgactgtaaagcccattgtaggtacaggtcagctagtgtgctccaatcct
ccccgtgaaacccatgagactggcactacaaatactgccaccaccaccacctcaaacatg
ggccaagggcagcctgatgatggacaaaaggaaccggctaacacttcctgccaaacaaag
cagacaggtagcaccagcactaccatgacgacaaaaacagatattcccacagagcatccg
tgtgcagttcaaattgtaagcttcgtgccagctgctggcttgcctagtgtcgcttctggc
actaccacagtgcaaagcggtgaaagactacaagccccgaaaaaaaaacagtgtgaatcc
catcatacccataccaccaatactgccactacagctcggtccctcatgggccaagggcag
ccagatggtgaatgggtgggatctgccaaccctccgtgccaaacacagcaaaccaactct
accagcaccaccatgtctgtcaaagttgatgtgccagttcagtcaagtgcgccttgcaag
acccataatacggataacaaggatacaaatcttcaagtgtgctctaacccaccttgtgaa
actcatgaaacaggtaccacaaatacagctaccgtaactacatcaaacctgggtgctacc
cagcgggtgtgctccaatccgccttgtgagactcatgaaacgggcaccaccaacacagct
accaccgcgacttccaacatagccacaggtcagcaggtgtgctccaatccaccatgtgaa
actcatgagaccggtactacgaacacagccaccaccaccacatcaaacctgggagctgga
caaaatgaaagtgcccagcaccagcaaccccctgttactccaccctgtgaaacacagcaa
accaactccaccagcaccataatgacacccagcataggaggtgatgtcgctcagtcttcc
agctcagcatcagcacaatgtggcaactcagaacagagaaaaactcccgagcgagaatca
ccagggactgctgggtctttgcctcagagctcaacacccagaatatgctcaaaccctcct
tgtgagacccatgaaacaggaaccactcatactgccaccacagtaacttcttctatgggt
gccaaccaagatcagccacctgctaccaatgggcaacaaggggaacctgagatacctgtg
actgagagtccagctgccagcagccccagtgctgctgtggtgaccacagtttccaccact
caaatcagagctgtcactactgtcacccagtccacgccagcaccagggccttctgtaccg
aacatctccacgcttgctgatgtccctgcagacgaggcagttccacctgctgaggctcct
gataccaccagcacagattcccttccggcaccctctgagccactgcagccctccatagag
atgcagagagcagttgcaacccctgaacctcagggacaagcacaggttgcctcaattgcc
tcaactggcactccgccaactgaaggtcctctgggtgaaactgctccccatccagaactt
gtccctcctactgaagagacaccacccacaccagcaccccccgcccaagaacctgtggct
atggtggtgctgccccaggccacacctgcagctccaccatcctcagaggtggagcagtta
gcattgcctcaggaactaatggcagagagccaggcaggcaccaccactctgatggtgact
ggattgactcctgaggaactagccgtaacggctgctgcagaggctgctgctcaagctgct
gccactgaagaggcacaagcgctggccatccaggcggtcttgcaagcagcccagcaggct
gtaatgggtcctggagaagccatggatacttcggaagcagcagcaacacaggctgaacta
ggccacctgagttcagagggccctgaaggacagcccaccgcgatccccattgtgcttact
cagcaagacttggcagccttggtgcagcagcaacaacagcagcttcaggaggctcaggca
gcagcggcagcagcagcagctgcagttcagcagcagcaacagcagcagcagcaacagcaa
cagcagccccctcagcatcaactgcctgcccacttgcctacagaagccctggctcctgct
gatagcctcaacgatcctgccagtgagagcaatggcctcaatgagttggctagtgcagtg
accagcacggttgggctgttacctcccactcccacagagagtcttgctccttcaaataca
tttgtggccccacagcctgtggtagtagccagcccagcaaaattgcaggcagcagctgcc
ctgacagaagttgctaatgggattgaaccagctccagtgaaaccagagcctcccacacag
cttccaaaagtgattgtgaagaaggaaaatcaatggtttgatgtgggtattgtcaaggca
accaacatggtggtgacacactacttcctgccgcctgatgatgcacctgctacagatgat
gattcaggaaccactcctgattattctcaattcaagaagcaggagctgcagcctggtact
gcttataagttccgagtagcaggaattaatgcctgcggacgaggccctttcagtgaaatc
tcagcattcaagacctgtttgcctggttttcctggagcaccttgtgccattaaaatcagt
aagagtccagacggagcccacctgacttgggaaccaccttcagtcacctctggaaaaatc
acagaatactcggtgtacctagccatccagagtccccaggcgggtgaacctaagaccgca
gcacctgcccagctggccttcatgcgggtttactgtgggcccagtccttcgtgcctggtc
cagtctgctagtctctccaatgcccatatagactacaccacaaagcctgccattattttc
cgcattgctgcccgcaacgagaagggctatggtcctgccacacaagttcggtggcttcaa
gaatccagtaaagatggatctatgacaaaaccaactaacaagcggccgctttcatcttct
gatctgaaaagtgctccaaagaagcccaaagcagatgggcagtga

DBGET integrated database retrieval system