KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107284503Help
Entry
107284503         CDS       T05763                                 

Gene name
DLAT
Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur00010  Glycolysis / Gluconeogenesis
pmur00020  Citrate cycle (TCA cycle)
pmur00620  Pyruvate metabolism
pmur01100  Metabolic pathways
pmur01200  Carbon metabolism
Module
pmur_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107284503 (DLAT)
   00020 Citrate cycle (TCA cycle)
    107284503 (DLAT)
   00620 Pyruvate metabolism
    107284503 (DLAT)
Enzymes [BR:pmur01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     107284503 (DLAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-GeneID: 107284503
NCBI-ProteinID: XP_015668058
Position
Unknown
AA seq 563 aa AA seqDB search
MWRVLVPLPALSPTMQMGTIARWEKKEGEKINEGDLIAEVETDKATVGFESMEECYLAKI
LVPEGTRDVPIGSIICITVDKPELIGAFKDYTLDSAAATPSASVPPPPPPAAPPKPAAQP
SAQAPGSSYPPHMQILLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEV
QEEGYLAKILIPEGTRDVPLGTVLCIIVEKESDIPAFADYRDVGIADIKPPVSPPPLPPS
PAAAVSAQPVASPVKTPAHKGRIIVSPLAKKLAAERGIDLSQVKGTGPEGRITKKDIDSF
VPSKVAPAPAPGAVPLAAPSPTVARGVAAAAPTGVFTDIPISNIRKVIAQRLMQSKQTIP
HYYLSVDINMGEILVLRKGLNQEMPQNTKLSVNDFIIKASALACLKVPEANSSWLETVIR
QNHVVDVSVAVSTPAGLITPIVFNAHTKGLASINQDVVTLASKAREGKLQPHEFQGGTFT
VSNLGMYGIKNFSAIINPPQACILAIGASEKRLVPADNEKGFDVASVMSVTLSCDHRVVD
GAVGAQWLAEFKRFLEKPATMLL
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgggtgctggtgcctttgcccgccctctcccccaccatgcagatggggaccatt
gcgcgttgggagaagaaagagggggagaagatcaacgagggagacttgattgcagaggta
gagacagacaaagcaacggtggggtttgagagcatggaagaatgctacctggccaagatc
ctggtccccgaaggaacgcgggatgttcccattggatccatcatctgcatcactgtggac
aagcctgaacttattggcgccttcaaggattatactttggattcagcagctgccacccca
tcagcctcggtaccacccccacctcctccagctgctccccccaaaccagcagctcagcca
tctgcacaagctccaggcagctcctatcctccccatatgcaaattcttcttcctgccctc
tctcctacaatgacaatgggcaccgtgcagaggtgggaaaagaaggttggcgagaagctg
agcgaaggagatttattggcagaaattgagacagacaaagcaacaataggctttgaagtg
caagaagaaggttacctggcaaagatcttgataccagaaggcacccgagacgtccccttg
ggaaccgttctctgtatcattgtggagaaggaatcggacattcctgcttttgcagactac
agagatgttgggatcgctgatatcaaacctcccgtgtccccaccgcctctgcccccaagc
ccagcagcagctgtttcagcccagcctgttgcctctccggtcaagactcctgcacataaa
gggaggataatagtgagccctctggcaaagaaattagccgcagagagaggaatcgatctc
tcgcaggtgaaaggtacagggccagagggacggatcacaaagaaggacattgactcattc
gtgccatctaaagttgccccggccccggcaccgggtgcggttcctctggctgcaccatct
cccacagttgcaagaggagtggctgcagctgcccccacaggtgtctttactgatattccc
attagtaatattcgaaaggtgattgcccagcgtttgatgcagtctaaacaaacgatacct
cactattatctctctgttgatataaacatgggagaaatattggtgctgaggaaaggactc
aaccaggagatgccacagaataccaagctctcagtcaacgacttcattattaaagcttca
gctctggcctgtttgaaggtgcctgaagcgaattcttcgtggctagaaacagtcattagg
caaaatcacgtagttgacgtaagcgtggcggtcagtactccagcagggcttataacgcca
attgtgtttaatgcacacacaaaggggttggcctccattaaccaagatgttgtcacatta
gccagcaaagcgagggaaggcaagcttcagccccacgagttccagggaggaaccttcaca
gtctcaaatttaggaatgtatggcattaagaatttttcggctataatcaatccaccgcag
gcttgtattttggcaattggtgcctctgagaaaaggctggtcccggcagataatgaaaaa
gggttcgatgtggccagtgtcatgtctgtgaccctcagctgtgaccaccgtgttgtggac
ggggcagtgggggcccagtggctcgcagaattcaagagattcctggaaaaaccagctacg
atgctgctatag

DBGET integrated database retrieval system