KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107284581Help
Entry
107284581         CDS       T05763                                 

Gene name
CWC27
Definition
(RefSeq) spliceosome-associated protein CWC27 homolog isoform X1
  KO
K12737  peptidyl-prolyl cis-trans isomerase SDCCAG10 [EC:5.2.1.8]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pmur03041]
    107284581 (CWC27)
   03110 Chaperones and folding catalysts [BR:pmur03110]
    107284581 (CWC27)
Enzymes [BR:pmur01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     107284581 (CWC27)
Spliceosome [BR:pmur03041]
 Complex C
  Other components
   PPlases
    107284581 (CWC27)
Chaperones and folding catalysts [BR:pmur03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    107284581 (CWC27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 107284581
NCBI-ProteinID: XP_015668147
Position
Unknown
AA seq 472 aa AA seqDB search
MSNIYIQEPPTNGKVLLKTTAGDIDIELWSKEAPKACRNFIQLCMEGYYENTIFHRVVPE
FIIQGGDPTGTGSGGESIYGAPFKDEFHSRLRFIRRGLVAMANSGPHDNGSQFFFTLGRA
DELNNKHTIFGKITGDTVYNMLRLSEVEIGMDERPVNPYKITSTEVLFNPFDDIIPRISK
KLKNEKPMEEVEKAKSKGTKNFSLLSFGEEAEEEEVEVNRVSQSMKGKSKSSHDLLKDDP
HLSSVPAIDSEKANESDNSDKGEEEGYCDEDDGLDSEEKYQMKKRVMEKLKKNTDVPIKK
ITEGEQKQKSSRSEELRKEVRQLKRELIKAKQNKEENPSKVKENPLEEEEAAPNSIVAEY
LEEKKKYEELRKQQPKKGSSREDQTLVLLDQFKSKLNQAISETPEDEVPEPEVENDEGWM
SHVLHFEDKTRKVKDANVQDEDTFEIYDPRNPVNKRRREESKKILREKKSRR
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatatttacatccaggaaccgccaaccaatggcaaggtattactgaaaacaaca
gctggagatattgatattgaattatggtcaaaagaagctcccaaggcatgtcgaaacttt
attcagctttgtatggaaggctattatgaaaacaccatatttcatagggttgtacctgaa
tttataatacaaggtggtgatccaactggtactggctcaggaggagaatctatctatgga
gcccctttcaaggatgaattccattcacgattgcgttttattcgacgaggactcgttgcc
atggcaaattccgggcctcatgataatggcagccagttcttttttactttggggcgtgcg
gatgaacttaacaacaaacacactatctttggaaagatcactggagatactgtatataat
atgttgcgactttcagaagttgaaattggcatggatgaaagaccagtcaatccatataaa
ataacaagtacagaggttttatttaatccctttgatgacataattccaaggatcagtaaa
aagctgaagaatgagaaaccaatggaagaagttgagaaggcaaaatcaaagggcacaaaa
aattttagcctgctttcatttggagaagaagctgaggaggaagaagtagaagtcaacaga
gttagtcagagcatgaaaggaaaaagcaaaagtagtcatgatttactgaaagatgatcca
cacctgagttctgttcctgccattgacagtgaaaaagcaaatgaaagtgataattcagat
aagggagaagaggagggatattgtgatgaagatgatggtcttgatagtgaagaaaagtat
caaatgaaaaaacgagttatggagaagttaaagaaaaatactgatgtacctattaaaaaa
ataactgaaggggagcaaaagcagaagagtagccgtagtgaggaactacggaaggaagtt
cgccagttgaaacgtgaactaataaaggcaaagcaaaataaagaagaaaatccctcaaaa
gtgaaagagaatccacttgaagaagaggaagctgctccaaacagcattgttgcagaatat
cttgaagaaaagaagaaatatgaagaattgaggaagcagcagccaaagaaaggatcttct
cgtgaagatcagacattggtgttactggatcaattcaaatcaaagctaaaccaggcaata
tcagaaacacctgaagatgaagtacctgaacctgaagtggagaatgatgaaggatggatg
tcacatgtgctccactttgaggataaaaccagaaaagtaaaagatgcaaatgtacaagat
gaagacacatttgaaatttatgatcctcgtaaccctgttaataagaggagaagggaggaa
agcaaaaagattctgagagaaaaaaagtcgaggagatga

DBGET integrated database retrieval system