KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107285103Help
Entry
107285103         CDS       T05763                                 

Gene name
CACNG3
Definition
(RefSeq) voltage-dependent calcium channel gamma-3 subunit
  KO
K04868  voltage-dependent calcium channel gamma-3
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur04010  MAPK signaling pathway
pmur04260  Cardiac muscle contraction
pmur04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107285103 (CACNG3)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107285103 (CACNG3)
   04261 Adrenergic signaling in cardiomyocytes
    107285103 (CACNG3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pmur04040]
    107285103 (CACNG3)
Ion channels [BR:pmur04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107285103 (CACNG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2
Motif
Other DBs
NCBI-GeneID: 107285103
NCBI-ProteinID: XP_015668739
Position
Unknown
AA seq 316 aa AA seqDB search
MRMCERGVQMLITTLGAFAAFSLMTIAVGTDYWLYSRGVCRTKSSSDNDTSRKNEEVLTH
SGLWRTCCLEGTFRGICKQINHFPDDADYDQDAAEYLLRAVRASSIFPLLSVGLLFFGGL
CVAASEFYKSKLNVILSAGIFFVSAGLSNIIGIIVYISANAGDPGQSDSKKSYSYGWSFY
FGALSFIIAEMVGVVAVHMYIEKHRQIRAKSHSVALLKKSTFARLPTYRYRFRRRSSSRS
TEPRSRDLSPIGKGFNTIPSTDISMFTLSRDPSKVTIGTLLNSERDHGFLQIHNSLPKEF
KESLHNNPANRRTTPV
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaggatgtgtgagcgcggcgtccagatgctgatcaccaccctgggcgccttcgccgcc
ttcagcctcatgaccatcgcggtgggcaccgactactggctctactcccgcggcgtctgc
aggaccaagtccagcagcgacaacgacaccagccggaagaacgaggaagtcctgacgcac
tcgggcttgtggcggacctgctgcctggaagggactttccgaggaatctgcaagcagatc
aatcattttccagatgatgctgactatgatcaggacgctgctgagtatctcttgcgtgct
gtaagagcctccagcatcttccccctcctcagtgtgggtctcctgttcttcgggggactc
tgcgtggcggccagtgagttttacaagagcaaactcaatgtcattctgagcgcaggcatc
tttttcgtttccgcagggctcagcaacatcatagggatcatagtttacatctcagccaat
gcgggggaccccgggcagagtgactccaagaagagctattcctatgggtggtccttctac
tttggtgccctctccttcatcattgctgagatggttggtgttgttgctgtccacatgtac
atcgaaaagcaccgccagatccgggccaagtctcactccgtggccctcctgaagaagtcc
acctttgcccgcttgcccacctatcggtaccggttccgacggcgatccagctcccgctcc
acagagccacggtcgagggacctgtctcccatcggcaaaggctttaataccatcccgtcc
actgatatctccatgttcactctttccagggatccttccaaggtgactattgggactttg
ctgaactcagagagagatcacggttttttacagatccacaactccctccccaaagagttc
aaagaatctttgcataacaaccctgccaacagacgaaccactcccgtctga

DBGET integrated database retrieval system