KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107285106Help
Entry
107285106         CDS       T05763                                 

Gene name
MINPP1
Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur00010  Glycolysis / Gluconeogenesis
pmur00562  Inositol phosphate metabolism
pmur01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107285106 (MINPP1)
   00562 Inositol phosphate metabolism
    107285106 (MINPP1)
Enzymes [BR:pmur01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     107285106 (MINPP1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     107285106 (MINPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF4708 NLRC4_HD2
Motif
Other DBs
NCBI-GeneID: 107285106
NCBI-ProteinID: XP_029139434
Position
Unknown
AA seq 474 aa AA seqDB search
MGNPATCRRFVSILLLLELLLLPANGESQGEAERATLLSPFFGTKSRYEELHPYLLRDPF
SLGPALSGFPLPPASCTPLQLSAVVRHGTRFPTRKQIEKLARLHGLLRGDGKRCSVAERL
ARWEMWYQPDMDGKLAPKGERDMRMLAKRLVARFPSLLAPGRRLAFTSSSKHRCVDSSGA
FRAGLREALYGQLSDGEKNVTLTETFEINDKLMRFFDHCEKFVRDVEDNDTALYEVDAFK
ESPEMMKIVNKTTHTLCLPVEDLNADLLQVAFFTCSFGLSIKNISSPWCSLFNKEDAKVL
EYLNDLKQYWKRAYGYNINSQSSCVLFQDIFENLDKAVSESKRSKPISSPVIIQFGHAET
LQPLLALMGYFKDKVPLNASNYHSQSKRKFRSGRIVPYAANLLFVLYHCDQARSPKDEYK
VQILLNEKLLPFTYSGKTVSLYTKLKNYYKYFLQNCEFAEVCNIKKNGTTINSL
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggggaacccagcgacctgccggcgcttcgtctcaatactgctgctgctggagctgctg
ctccttccggccaacggggagtcgcagggagaagccgagcgagccacgctgctgagcccc
ttcttcggcaccaagtcccgctatgaagagctgcacccgtaccttctccgggacccattc
tcgctcgggccggcgctctcgggctttccgctgccgccggcctcctgcaccccgcttcag
ttgagcgccgtcgtgcgccacggcacgcgcttccccacccgcaagcagatcgagaagctg
gcgcgcctgcacggcctcctacggggcgacggcaagcgctgctcagtagcggagcgcctg
gcgcgatgggagatgtggtaccagccggacatggacgggaagctggcccccaaaggggag
cgcgacatgaggatgctggccaagcgcctcgtcgcccgcttccccagcctcctggccccc
ggtcggcgcctggcttttaccagcagctccaagcaccgttgcgtggatagcagcggggcc
ttccgcgcaggactccgcgaggcgctttacgggcagctgagcgacggcgagaaaaacgtt
accttgacagaaacatttgaaatcaatgacaaattgatgagattttttgatcattgtgaa
aaatttgtacgagatgttgaagacaacgatacagcattatatgaggttgatgcttttaag
gaaagccctgagatgatgaagatagtgaataaaaccacacatactttatgtctaccagtg
gaagacttaaatgcagatttgttacaagtggcattttttacatgctcctttggactaagt
ataaaaaacattagctccccctggtgttcactgttcaacaaagaagatgccaaggtactt
gagtatctgaatgatctcaaacagtactggaagagagcctatggatataatatcaacagt
cagtccagctgtgtacttttccaggatatcttcgaaaatttggacaaggcagtttcagaa
agtaaaagatcaaaacctatttcttcgccagtgatcatccaatttggacatgcagagact
cttcagccacttctcgcactcatgggctattttaaagacaaagtgcctcttaatgccagc
aactatcacagtcagtcaaaacgcaagttccgtagtggccgtatcgtcccttatgctgcc
aatttgttatttgtgctttatcattgtgatcaagctagatctcctaaagatgagtataag
gttcagattcttttgaatgaaaagctcctgccctttacctactcagggaaaacagtttct
ttgtacaccaaactgaaaaactattacaaatatttccttcagaattgtgagtttgcagaa
gtgtgcaatatcaagaaaaatggtactaccattaattcgttataa

DBGET integrated database retrieval system