KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107285298Help
Entry
107285298         CDS       T05763                                 

Gene name
ROCK1
Definition
(RefSeq) rho-associated protein kinase 1
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur04270  Vascular smooth muscle contraction
pmur04350  TGF-beta signaling pathway
pmur04510  Focal adhesion
pmur04530  Tight junction
pmur04810  Regulation of actin cytoskeleton
pmur05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    107285298 (ROCK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107285298 (ROCK1)
   04530 Tight junction
    107285298 (ROCK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107285298 (ROCK1)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107285298 (ROCK1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107285298 (ROCK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pmur01001]
    107285298 (ROCK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pmur03036]
    107285298 (ROCK1)
Enzymes [BR:pmur01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107285298 (ROCK1)
Protein kinases [BR:pmur01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   107285298 (ROCK1)
Chromosome and associated proteins [BR:pmur03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    107285298 (ROCK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Rho_Binding PH C1_1 APH Pkinase_C HR1 Cortex-I_coil DUF1192
Motif
Other DBs
NCBI-GeneID: 107285298
NCBI-ProteinID: XP_015668961
Position
Unknown
AA seq 1376 aa AA seqDB search
MSTGESFESRFEKIGMMIKDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDTFLTKYK
DTINKVRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSSRKVYAMKLLSKFEMIKRSDSAF
FWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTA
EVVLSLDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDY
ISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLSFP
DDNEISKDAKNLICGFLTDREVRLGRNGVEEIKRHPFFKNDQWSWENLRDSVAPVVPDLN
SDIDTSNFDDLEEDKSEEETFPIPKAFVGNQLPFVGFTYYSNHQYLSTCTANSNDNRTTT
NVDKNLLESLQKNIYQLEEQLHNEMQLKDEMEQKFRTSNIKLDKIMKELDEEGNQRKNLE
STVTQVEKEKMLLQHRISEYQRKAEQENEKRRNAENEVSTLKDQLEDLKKISQHSHITNE
KITQLQKQLEEANDLLRTESDTAARLRKSHTEMSKSISQFESLNRELQERCRILENTKLQ
VEKDYFQLQGALEVERRDRSHGSEIIGELQARITSLQEEIKGVKNNLERVEEERKQAQDM
LNHSEKEKNNLEIDLNYKLKTVQQRLEQEINEHNINKARLTDKHQSIEEAKSVAMYEIEK
KVKEERAAREKAENRIVQIEKQCSMLDFDLKQSQQKIEHLIEQKERLEEEVKNLTLQFEH
EINKRVMTQNELKMHAIEADSLKSSEKQLKQEINALLEAKRLAEFELAQLAKQYRGNEGQ
MRELQDQLEAEQYFSTLYKTQVKELKEEIEEKNKETQKKIQELLNEKETVVTQLDLAETK
AESEQLARALLEEQYFELTQESKKAASRNRQEIIDKDNIVSRLEETNNTLTKDVAFLTKE
NSELNENLKKLEGEYTLTKEKEFNLIRTQYEKNLNNERTLKTQAVNKLAEIMNRKDFKLD
RKKVNMQDFKKKEKENRKLQLELNQEKEKFNQMVIKYQKEVNEMQAQLVEESTYRNELQM
QLDSKESDIEQLRSKILDLQQGMDSTSVASLQADETDGSVTESRIEGWLSIPNKGNIKRY
GWKKQYVVVSSRKILFYNDEQDKEQSNPSVVLDIDKLFHVRPVTQGDVYRAETEEIPKIF
QILYANEGECRKDLEVESIQPVEKTNFLHHKGHEFVPTLYHFPANCEACAKPLWHVFKPP
PAVECRRCHVKCHKDHLDKKEELIAPCKVSYDITSARDMLLLASCQEDQKKWVSHLIKKI
PKTPPSSFVRASPRTHSTRSTANQSFRKVKNTSGKARSKEYGSVGDITHSENSSYC
NT seq 4131 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacaggagaaagctttgagtcccggtttgaaaaaatcgggatgatgataaaggac
cccaaatctgaagtgaattcggattgcttactggatggattagatgccttggtatacgat
ttggattttcctgctttgaggaaaaataaaaacatagacacctttttaaccaaatacaaa
gacacaataaataaagtaagagatctccgtatgaaagctgaagattatgaagtagtaaaa
gtgattggtagaggagcatttggagaagttcaattggtaagacacaagtcatcacgaaag
gtctatgccatgaaacttctcagcaaatttgagatgataaaaagatcagattctgcattc
ttttgggaagaaagagatatcatggcatttgcaaatagcccttgggttgttcagttgttt
tatgcattccaagatgatcgttacctttatatggtgatggaatatatgcctggtggggat
ctggtaaatttaatgagcaactacgatgtccctgaaaaatgggcaagattttatacagca
gaagttgttctttcattagatgctattcactccatgggttttattcacagagatgtaaag
cctgataatatgctgctagacaaatctggtcatttaaaactagcagattttggtacctgt
atgaaaatgaataaggaaggtatggtacgatgtgatacagctgttggaactccggattat
atatccccagaagtattaaaatcacaaggtggtgatggttattatggaagagaatgtgac
tggtggtcagttggtgtttttttgtatgaaatgcttgtgggggatacacctttttatgca
gattctttggttggaacatatagcaaaattatgaaccataagaattctcttagcttccct
gatgataatgagatttctaaagatgcaaaaaatcttatttgtggctttctaacagacagg
gaagttagattagggagaaatggcgtggaagaaatcaagcgacatccatttttcaaaaat
gatcagtggtcttgggaaaatcttagggactctgtagcacctgttgtgcctgatttaaat
agtgatattgacactagtaactttgatgatctggaggaagacaaaagtgaagaagaaaca
tttcctataccaaaagcctttgttggcaaccagctaccttttgtaggatttacttattat
agtaatcatcagtatttatctacctgcacagctaattcgaatgacaacagaacaactacc
aacgtagataaaaacttgttagaatctttgcaaaaaaatatttatcagcttgaagaacaa
ctacataatgaaatgcagttaaaagatgaaatggaacaaaaattcagaacatcaaatatt
aaattagacaagataatgaaggaactagatgaagagggaaatcagagaaaaaatttggaa
tcgacagttactcaagtagagaaggaaaagatgctcttgcaacacagaattagtgaatat
caaagaaaagctgaacaggagaatgagaaacgtcgaaatgcggaaaatgaagtatcaaca
ttaaaagatcagctggaagacttaaaaaaaattagtcaacactcacatattacaaatgaa
aaaattacacagttgcaaaagcaacttgaagaggccaatgatttgctgagaacagagtca
gatactgcagcaagactaaggaaaagtcatacagaaatgagcaagtcaataagtcaattt
gaatcattaaatagggagttgcaggagagatgcagaattctagaaaacacaaaattacag
gtggaaaaggattatttccagctacaaggagcactagaagtagaacgaagagataggagt
catggatcagaaattattggagaactacaagctcgcattacatctttacaagaagaaatc
aaaggtgtgaaaaacaatcttgagcgagtagaagaagaaagaaaacaggcccaagacatg
cttaatcattctgaaaaggagaagaataacttagaaatagatctaaactacaaacttaaa
acggtacaacaacgtttagaacaagaaataaatgaacataacataaacaaagctcggtta
actgacaagcatcagtcaatagaagaggccaaatctgttgctatgtatgaaattgaaaaa
aaggttaaggaagaacgagcagcaagagagaaggcagaaaatcgaatagttcagattgaa
aagcaatgttccatgttagactttgatctgaagcaatcacagcagaagattgagcacctt
attgaacagaaagagagactggaagaggaggttaagaatctgacacttcaatttgaacat
gagataaataaaagagtgatgacacagaatgaactgaagatgcatgctatagaagcagat
agtttaaagagttcagagaaacagctaaaacaggagatcaatgcattgttggaagcaaaa
agattagcagaatttgaattggctcagctggctaagcaatacagagggaatgaaggccaa
atgcgtgaattacaagatcaactagaagctgaacaatatttttctacactttataaaact
caagttaaagaactcaaagaagaaattgaggaaaaaaataaagaaacacagaaaaaaata
caagagctgctaaatgaaaaagaaactgttgttacacagttagatttggctgaaacaaaa
gctgaatctgaacaattagcccgagctctccttgaagaacaatattttgaactaacacaa
gagagtaagaaagcagcatcacgaaatagacaagaaattattgataaggacaatattgtc
agtcggcttgaagaaacaaataatacattaaccaaagatgtggcctttctaacaaaggag
aattctgagctaaatgaaaatcttaaaaaacttgaaggagagtatacattgacaaaagaa
aaggaattcaacctaattagaacacagtatgaaaaaaacttgaacaatgaaaggacactt
aaaacacaggctgtcaacaaattggctgagattatgaatcgaaaagattttaaactagat
agaaagaaagtaaatatgcaagatttcaagaaaaaagagaaagaaaaccgaaagttacag
ttggaacttaaccaggaaaaggagaaatttaatcagatggtaataaaatatcaaaaggag
gttaatgaaatgcaggcgcaactggtggaagagtccacatacaggaatgaacttcagatg
cagctggacagtaaagagagtgatatagaacaattacgtagtaaaattttagatttgcag
cagggcatggactctactagtgttgccagccttcaggctgatgaaacagacggaagtgtt
acagaatcaagaatagagggctggctttcaataccaaacaaagggaatattaaacgttat
gggtggaagaagcagtatgttgtggtcagcagcaggaagattctattctataatgatgaa
caggataaagagcaatctaatccatctgtggtattggatatagataaattgttccacgta
agaccagttacacagggtgatgtttatagagcagaaactgaagaaatacctaaaatattt
cagatcctatatgccaatgagggagagtgtaggaaagacttggaagtagaatcaatacag
ccagtagagaagacaaattttctgcatcataaaggtcatgaatttgttccaactttatac
cattttccagccaattgtgaggcttgtgccaagcctctatggcacgtatttaagccaccc
cctgcagtggaatgtcggcgatgccatgttaagtgtcacaaagatcacttggataaaaaa
gaagaattaatagcaccatgtaaagtaagttacgacataacttcagcaagagacatgctg
ctgttggcatcctgtcaggaagatcagaagaaatgggtttctcatttaataaagaagatc
cccaaaacaccaccatctagttttgttcgtgcttcaccaaggactcattccacaagatct
acagcaaatcagtcattcaggaaagttaaaaatacttctggaaaagctaggtcaaaggaa
tatggatctgtgggggacattactcattcagagaattcaagttactgttaa

DBGET integrated database retrieval system