KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107285361Help
Entry
107285361         CDS       T05763                                 

Gene name
HAO1
Definition
(RefSeq) hydroxyacid oxidase 1
  KO
K11517  (S)-2-hydroxy-acid oxidase [EC:1.1.3.15]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur00630  Glyoxylate and dicarboxylate metabolism
pmur01100  Metabolic pathways
pmur01200  Carbon metabolism
pmur04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    107285361 (HAO1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107285361 (HAO1)
Enzymes [BR:pmur01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.15  (S)-2-hydroxy-acid oxidase
     107285361 (HAO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FMN_dh IMPDH ThiG His_biosynth Glu_synthase NMO TMP-TENI CdhD
Motif
Other DBs
NCBI-GeneID: 107285361
NCBI-ProteinID: XP_015669027
Position
Unknown
AA seq 370 aa AA seqDB search
MSERPICIADFEKFAKKFLQKSVYDYYKSGADDQQTLAENVAAFSRLRLYPRMLKNVSTL
DLSTCVLGEKISMPICIAATAMQCMAHADGEIATARACRSAGTGLMLSSWSTTSIEEVAQ
AAPKTILWLQLYIYKDRQVTRSLVRRAEKAGYKGIFVTVDTPYLGKRLDDVRNKFHLPPH
LRMKNFDTNDLAFSSEKGYGENSGLSVYVAEAIDPSINWDDLKWLRGLTSLPIVAKGILR
ADDAREAVKLGVNGILVSNHGARQLDGVPATIDVLPEIIDAVEGKTEVFLDGGIRRGTDV
LKALAFGAKAVFVGRPVIWGLAYQGEDGVKEVLQILKEEFKLAMALSGCPSVEAIDRTLV
RRVQWEASKM
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaagaccaatttgcattgctgattttgaaaagtttgctaagaaatttcttcaa
aagtctgtgtacgattactataagtctggggctgatgatcagcaaaccttagctgaaaat
gtagctgcattttcaagattaagactatacccccggatgttgaaaaatgtgtcaaccttg
gacctgtcaacttgtgtcttgggagagaaaatcagtatgccaatatgcattgcagccact
gccatgcagtgcatggctcatgcagatggggaaattgcaactgctagagcctgtaggtca
gcaggaacagggttgatgctgagttcatggtccacaacatctatagaagaagttgctcag
gcagctccaaagacaattctctggttgcagctgtatatttataaggaccggcaggtcacc
aggtctttggtgcgtcgggctgaaaaagctggatacaaaggcatttttgtgactgtggac
accccgtatctcggaaaacgcttagatgatgtacgcaacaagtttcatctgcctccgcat
ctcagaatgaaaaattttgacaccaacgatctggcattttcatccgaaaagggttatggt
gaaaacagcggtctgtctgtttatgtagcagaggcaattgatccatcaatcaactgggat
gatttgaaatggctcagaggactgacttcattgcccattgttgctaaaggaatcctccga
gctgatgatgctagagaagcagtaaagcttggcgtaaatgggattctggtatcaaatcat
ggcgcacgtcaactggatggtgttccagctactattgacgtcctacctgaaataatagat
gcggtggaagggaaaactgaagtatttctagatggtggaataagaagaggcacagatgtt
ctcaaagccctggcttttggggccaaagcagtctttgtaggaaggcctgtaatctggggt
cttgcctaccagggcgaagatggtgtgaaggaagttcttcagatattgaaagaagagttc
aaattagcaatggcgctctctggttgtccaagtgtagaagcaatagacagaacattggta
cggagagttcagtgggaagcttccaagatgtag

KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107285787Help
Entry
107285787         CDS       T05763                                 

Gene name
HAO2
Definition
(RefSeq) hydroxyacid oxidase 2
  KO
K11517  (S)-2-hydroxy-acid oxidase [EC:1.1.3.15]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur00630  Glyoxylate and dicarboxylate metabolism
pmur01100  Metabolic pathways
pmur01200  Carbon metabolism
pmur04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    107285787 (HAO2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107285787 (HAO2)
Enzymes [BR:pmur01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.15  (S)-2-hydroxy-acid oxidase
     107285787 (HAO2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FMN_dh IMPDH Glu_synthase His_biosynth DHO_dh NMO
Motif
Other DBs
NCBI-GeneID: 107285787
NCBI-ProteinID: XP_015669521
Position
Unknown
AA seq 355 aa AA seqDB search
MTLVCLSDFEAYAKKHLPKPIWDYFAAGADECYTRDDNLMEYKRIYLRPRVLRDMSAIDP
RTTILGSEVDFPVGIAPTGFHGLACPDGEQSTAQAAEAMNTCYITSTYSTFSVEEIVAAA
PTGLRWFQLYLHRKRTFSEQLVRRVNALGFHALVLTVDVPYTGKRRNDIRNNYEFLKSIQ
VKNFKGAFEDEDQTEYGLPPGSIDPSIHWNDITWLQSLTQLPIIIKGILTKEDAELAVRH
GVQGIIVSNHGGRQLDGVLPTIAALVEVTTAVQGKIEVYLDGGIRTGNDVLKALALGAKC
VFIGRPTVWGLAYKGKEGLQEVLKILKDEFCLSMALTGCKNVSEIGRHLVQYSKL
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgactcttgtctgtttgtcagattttgaagcttatgctaaaaagcatcttcccaagcct
atctgggattattttgcagcaggtgctgatgaatgttatacgcgtgatgacaatctcatg
gaatataaaagaatctatttgaggccacgtgtgctgcgggatatgtcagcaatagatcca
aggactacgattcttggctctgaagttgacttcccagtggggattgctcccactggcttc
catggtttggcctgtcctgatggggagcagagcacagctcaagctgcagaagctatgaat
acctgctacataaccagcacatattccactttctctgtggaagaaattgttgctgctgca
ccaactggtttaagatggttccaactctacctccatcggaagaggacgttctcagagcaa
ctcgtacgaagggttaatgcattgggattccatgccctggtgctcacagttgacgtgccc
tacactggcaagaggcggaatgacattcgcaacaactacgagttcttgaaatccattcaa
gtgaagaactttaaaggagcttttgaggatgaagaccagactgaatatggtctaccccct
ggatccatagacccatctatccattggaacgacatcacctggctacaaagcctgacccag
ctgccaatcatcatcaaagggattctgacaaaggaagatgctgagctagctgtgagacat
ggtgttcaagggattatcgtatccaaccacggaggaaggcagctagatggagtccttcct
actattgctgctctggttgaagttactaccgcagtgcaaggcaaaattgaagtttactta
gatggtggaatacgaactgggaatgatgtattgaaagcattggcacttggagcaaaatgt
gtcttcatcggcaggcccactgtatggggtctggcttataagggtaaagaaggacttcaa
gaagttttgaagattttaaaagatgaattttgtctatcaatggctctcacaggctgtaaa
aacgtctcagaaattggccggcatcttgttcagtattccaaattgtaa

DBGET integrated database retrieval system