KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107285869Help
Entry
107285869         CDS       T05763                                 

Gene name
TMPRSS15
Definition
(RefSeq) enteropeptidase
  KO
K01316  enterokinase [EC:3.4.21.9]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pmur01002]
    107285869 (TMPRSS15)
Enzymes [BR:pmur01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.9  enteropeptidase
     107285869 (TMPRSS15)
Peptidases and inhibitors [BR:pmur01002]
 Serine peptidases
  Family S1: chymotrypsin family
   107285869 (TMPRSS15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin CUB MAM SEA Ldl_recept_a DUF1986 SRCR SRCR_2
Motif
Other DBs
NCBI-GeneID: 107285869
NCBI-ProteinID: XP_029139603
Position
Unknown
AA seq 964 aa AA seqDB search
MGIFTIKSGAMFSPALQNKSSVDFKILAFDVQQMVDDMLHASELQNEYKGSKVTQFRNGS
VIVFFKLFFVQRVSEVKIKNALVYGIKENKSELLQTFTIDVNSIEIIDLGIFTTSSSLTT
PGKCLPSDDICADDITCIRKELFCDGIPHCPDGSDENKCATPCDGKFILDGLSGSFHSIH
YPEPYSSNIVCRWIINMEKHLSIKINFTAFETEEFFDSLSIYEGIGPTKILRAQASGSNP
GTVYIFSDKATVEFVTDLYETHNGFNATYTAFNASELTNNEKINCTFEDGFCYWIQHIKD
GIEWNRVNGPVFPTTTGPDFDHTFGNLSGYYILTPFRRSEQLRTEMFSLPLDPISDAYCL
SFWYYMYGINVYRLNVKIVYDDNSEKIIFQKEGNYGKIWNYGQITLNETSKFKVAFEAFN
RRGWNDIALDDMGLSNGACAISIYPEPTLVPTIPTTFLLATDCGGPYDLWEPNTTFTSMN
YPNNYPSKVSCVWYLNAEKGKNIQLHFQYFNLEDIYDVVEVRDGRGAESLFLAVYTGKSP
LPDIFSTTHQMTVLFITDKSVTRKGFVANFTTGYHLGMPAPCGLNYFQCGSGECIPQAQN
CDQFQHCKDNSDEADCVHLINGSLSSNGLVQYKIETQWYTACANEWTEASSTTICNLLKL
GTGNKSTPVLYTGAGPFVEVKKAANNSFMLKPRVKCLNNLVIHLQCSGKSCGKKMITQKS
RPRIVGGSDAQEGAWPWIVSLYFNYRPTCGASLINNEWLLSAAHCVYGRNLKPSEWKAVL
GLHTNLNLSYPQTVSREIDQIIINPHYNKRTKDSDIALMHLQFRVNYTDYIQPICFPEKN
KQFLPGTKCSIAGWGKTTPEGMSLYYPISSILQEAEVPLITHQKCKELMPEYNITENMIC
AGYDEGGIDSCQGDSGGPLMCQENKKWFLAGVTSFGYKCALPNRPGIYANVFKFVDWIKR
TINY
NT seq 2895 nt NT seq  +upstreamnt  +downstreamnt
atgggaatatttacaataaaatcaggagcaatgttcagccctgctttgcaaaataaatca
tcagtagacttcaaaattcttgcctttgatgtccagcaaatggtagatgatatgttacat
gcaagtgaacttcaaaatgaatataagggaagtaaagttacgcagtttagaaatggtagt
gtaattgtattcttcaaacttttctttgtacaacgggtgtctgaagtaaagataaagaat
gcattggtctatggcatcaaggagaataaaagtgaactcttacagacttttaccattgat
gtgaacagcatagaaataatagatttgggaatatttactacaagcagctctttgacaaca
cccggtaaatgtttgccttcagatgatatttgtgctgatgatataacctgcatcagaaag
gaattattttgtgatggaataccacactgcccagatggctctgatgaaaacaaatgtgct
acaccctgtgatggaaaattcattctagatggtttatccggatctttccattctattcat
tatccagaaccctatagctcaaatattgtttgccgatggataataaatatggagaagcac
ctatctatcaaaataaacttcactgcttttgagacagaagaatttttcgatagtctaagt
atttatgaaggtataggtccaacaaagatattaagagctcaagcctcaggttctaaccct
gggacagtttatattttctctgataaagccactgttgaatttgtcacagatttatatgaa
acccataatggttttaatgcaacctacactgctttcaatgcaagtgagctaaccaacaat
gaaaaaatcaattgtacttttgaagatgggttttgttactggattcaacatataaaggat
ggcattgaatggaatagagttaatggccctgtctttcctactacaactggtccagatttt
gatcatacctttggcaatttatcaggctactatattttaacaccatttcgtagaagcgaa
caactgaggactgaaatgtttagcttacccttagaccctatttcagatgcatactgccta
agcttctggtattacatgtatggcattaatgtttaccgtctaaatgttaaaattgtatat
gatgataacagtgaaaagatcatcttccagaaagaaggaaattatggaaagatttggaat
tatggacaaataacattaaatgaaacatctaaatttaaggttgcttttgaagcctttaat
agaagaggttggaatgatattgcccttgatgatatgggactttcaaatggagcctgtgct
ataagtatttatccagaaccaactttggtccctacgattcctacaacatttctgctagca
actgattgtggaggtccatatgatttgtgggaaccaaacactacatttacttcaatgaac
tacccaaacaactatcccagtaaagtgtcttgtgtatggtatttgaatgcagaaaaagga
aaaaacattcaacttcatttccagtattttaatttagaggatatttatgatgttgtagaa
gtcagagacggtagaggagctgagtctttatttttagctgtatatactggaaaatcacca
ttgccagatatattctctacaactcaccaaatgactgtgctcttcattacggacaaatct
gtaaccagaaaaggatttgtagccaattttactacaggttaccatcttggcatgccagct
ccatgtggactgaattattttcagtgtggaagtggagaatgtataccccaggctcagaat
tgtgaccaattccagcactgtaaagataattctgatgaagcagattgtgtgcacttgatc
aatggttctctcagctccaatgggttagttcaatacaaaattgagacgcaatggtataca
gcctgtgctaatgagtggacagaagcatcatcaaccactatctgcaatctgttaaaacta
gggactgggaacaagtcaactcctgtcttgtataccggggcaggtccatttgtagaagtt
aaaaaagcagctaacaacagcttcatgctaaaaccaagggtaaagtgtttgaataatttg
gtgattcatttgcaatgcagtggtaaatcttgtggaaaaaaaatgattacccagaaatct
agaccaagaattgttggtggttctgatgctcaagaaggtgcttggccttggatagtttca
ctatatttcaattacaggccaacttgtggagcttctcttatcaacaatgaatggctactc
tcagctgcacattgtgtatatgggagaaatttaaaaccatctgagtggaaagcagttctt
ggcctgcatacgaatctcaatctatcatatcctcaaacagtgagccgagagattgatcag
attatcatcaatcctcactataataagcgaacaaaagatagtgacattgctttgatgcat
ctccaatttagagtgaattacacagattatattcagcccatttgcttcccagaaaaaaat
aaacaatttttgccaggaactaaatgctctattgctggctggggaaaaaccacaccggaa
ggtatgtcactgtactatccaatctcaagtatattgcaagaagcagaagtccctcttata
acacatcagaaatgcaaggaactgatgcctgagtacaatattactgaaaacatgatatgt
gctggatatgacgaaggtggaattgattcctgccagggagattctggtggacctctgatg
tgtcaagagaacaaaaagtggtttttagctggtgtaacatcctttggctacaagtgtgca
cttccaaatcgacctggaatttatgcaaacgttttcaaatttgtagactggataaaacgt
accattaattattaa

DBGET integrated database retrieval system