KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107286594
Entry
107286594         CDS       T05763                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase type 4
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur00230  Purine metabolism
pmur01100  Metabolic pathways
pmur04020  Calcium signaling pathway
pmur04114  Oocyte meiosis
pmur04261  Adrenergic signaling in cardiomyocytes
pmur04270  Vascular smooth muscle contraction
pmur04371  Apelin signaling pathway
pmur04540  Gap junction
pmur04912  GnRH signaling pathway
pmur04914  Progesterone-mediated oocyte maturation
pmur04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107286594 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107286594 (ADCY4)
   04020 Calcium signaling pathway
    107286594 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107286594 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107286594 (ADCY4)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107286594 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    107286594 (ADCY4)
   04916 Melanogenesis
    107286594 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107286594 (ADCY4)
   04270 Vascular smooth muscle contraction
    107286594 (ADCY4)
Enzymes [BR:pmur01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     107286594 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053 CD52
Other DBs
NCBI-GeneID: 107286594
NCBI-ProteinID: XP_029139790
Position
Unknown
AA seq 1079 aa
MPCQRRPRTASDTPREDLFYQTYYCLSQQYPLILLLLVIVLSICAALIATTFCSGRDFSS
NLAFLITLFITLLIFSLILIFVCMENIFQRCTRLFSAVIWTCLITMGYVFIFVGGVVCAW
DQVSFFLFIIFIVYTMLPVGMKDAVIAGIVASLSHIIVLSIYLSMGHSSHSQLAVQQLAN
LVIFVCGNLVGAYHKHLMEVALGETFHETFNFIQSRVKLESEKRHQEHLLLSILPAYIAL
EMKAEIIERLRDGGQPQRQHESANNFHNLYVKRHQNVSILYADIVGFTLLASECSPKELV
LMLNELFGKFDQIAKDNECMRIKILGDCYYCVSGLPVSLPNHARNCVKMGLDMCRSIKKL
RDATGVDINMRVGVHSGNVLCGVIGLQKWQYDVWSDDVTLANHMEAGGVPGRVHITEATL
SHLGGMYTVEEVCCVRDSYLRENRIKTFLVVDPRAEEESSSDILSPAPGESFMMRASVRM
TRYLESWGAAKPFANLKPLDNLPGESPGFVRNNHSDISLGSLTMERCRAPRSPDEDLEGV
DEKFFQLIEQLNSQKQWKKSEDFNCITLYFKQESLEKEYRLSPLPSFNYYTACSFLVFVS
NFLIQILVVYKTEALGISYGISFFLFLLLLLTCFAGHLAKCFLKGPKILYWVPSILANVC
TQPWLRVSLGIITILVVLTMSVLNLFFMPETSCFLKLENSTLSGMNTVQEFSRFNSLFSV
PYYIYCCVLGFLSCSLFLHMNFELKLTMLILCLVVYNVLFLHTHSWLSDCYVSQLYRNQT
ALRPGVLKEPKVMGAFSFFVFFFTLLGLARQNEYYCRLDFLWKKKFKKEREEIETMENLN
RVLLENVLPADVAQQFIRQNRRNTDLYHQSYDCVCVLFASIPDFKEFYSESNVNHEGLEC
LRLLNEIIADFDELLLKPKFSGVEKIKTIGSTYMAATGLNVAAGQDNQQDTERSYTHLGT
MVEFAMALVAKLDIINKHSFNTFKLRVGINHGLVVAGVIGAQKPQYDIWGNTVNVASRME
STGVLGKIQVTEETAKALATLGYTCSLRGVIKVKGKGELRTYFVCTETARSCSQAPMLS
NT seq 3240 nt   +upstreamnt  +downstreamnt
atgccctgccagcgtcgtccacggacagccagtgacactcccagagaagacctcttctat
caaacctattattgcttgagccagcagtaccctctgattcttcttctcttggtcatcgta
ctgagcatctgtgcggctctcattgctaccaccttttgcagtggtagggatttctcctcc
aacttggctttcctgattacgttgttcatcactctgcttatcttcagcctcatcttgatc
tttgtgtgcatggaaaacatcttccagagatgcacccgcctcttctcagctgtcatttgg
acttgcctgatcacaatgggttatgtattcatctttgttggtggagtggtttgtgcttgg
gaccaggtctccttcttcctcttcataatcttcattgtctacaccatgttgcctgttggt
atgaaagatgcagtaattgccggtatagtagcttctctctcgcacatcatagttctgagt
atctacctctcaatgggccacagttcacattcacaactggctgtgcagcaattggccaat
ctagtcatctttgtctgcggtaacttggtgggtgcctaccacaagcatttgatggaggtg
gccctaggagagaccttccatgagaccttcaacttcatccaatctcgagttaagctggag
tcagagaagcgacaccaggaacatttgctgctctccatccttcctgcttacattgccttg
gagatgaaggccgagatcattgagcggcttcgggatggaggccagccccagcgccagcat
gagagtgccaacaacttccacaacctttatgtcaagaggcaccagaatgtcagcatcctc
tatgcagatattgttggcttcacacttttggccagtgaatgttctcccaaagagctggtg
ttgatgctcaatgaactcttcggcaaatttgatcagattgcaaaggataatgaatgcatg
aggatcaagatcttaggggattgctactattgtgtgtctggattgcctgtatctttgccg
aaccatgcccggaattgtgtcaagatgggccttgacatgtgtcggtccatcaagaagcta
cgtgatgccaccggagtggacatcaacatgagagttggagtccattcaggaaatgtcctc
tgtggggtgattggtctccaaaagtggcaatatgatgtctggtctgatgatgtgacatta
gccaatcacatggaggcaggaggcgtgccagggagagttcatatcacagaagctaccttg
tcacacctgggtggaatgtacactgtggaagaagtttgctgtgtgcgagattcttactta
agggagaaccgcatcaagaccttcttagttgtggatcccagagctgaagaagaaagctcc
agtgacattctctcacctgcaccaggtgagagcttcatgatgagggcctctgtccggatg
actcgctacctggaatcttggggagctgccaaaccctttgccaacctcaaacctctggac
aatctcccaggagagtcaccaggatttgttcggaataaccattcggatatctctttgggg
tctttgaccatggaacggtgccgtgcccccaggagtccagatgaagacttggaaggtgtg
gatgaaaagtttttccaactgattgaacagctgaactcccagaagcaatggaagaaatcc
gaagacttcaactgcatcacattgtacttcaagcaggaatctctggaaaaggagtaccgg
ctctcgccactaccatcttttaattactatacggcctgcagtttcctggtcttcgtttcc
aactttctcatccagatccttgttgtttataaaacagaggcattggggatctcctatgga
atttctttcttcctgtttctcctcctccttctcacctgctttgctggtcacctggcgaaa
tgtttcctgaaaggccccaagatcttgtattgggttccatccatcttggccaatgtttgc
actcagccatggctacgtgtctctttgggcatcatcaccattcttgtggttctcacaatg
tcagtgttgaacttgttctttatgccagagacctcatgctttttgaaacttgaaaattct
accttatcaggcatgaatactgtacaggaattctctcggtttaactccctcttcagtgtg
ccgtattatatctactgctgtgtcctgggatttctctcgtgttccctcttccttcacatg
aacttcgagctcaagttgaccatgctgatactttgccttgttgtctacaatgtgctgttc
cttcacacccattcctggctctctgactgctatgtctctcagctctaccgtaatcaaact
gcactcaggcctggggtgctgaaggagcccaaggtaatgggagcattctcattcttcgtt
ttcttcttcaccctcttgggtctggctagacagaatgagtattactgccgcttagatttt
ctctggaagaagaagttcaaaaaagaacgtgaagagattgaaaccatggagaatctcaac
cgggtcctcctggaaaatgttctcccagctgatgtagctcagcaattcattcgtcagaac
cggcgcaatacggatctctatcaccaatcttatgattgtgtctgtgttctctttgcttcg
atcccggacttcaaggaattttattctgaatccaatgtcaaccatgaagggcttgaatgc
ctccggctgctgaacgagatcattgctgactttgatgagctccttctgaaacccaagttc
agtggggttgagaagatcaaaaccattggcagcacttacatggcagctactggcttaaat
gtggcagctggacaggataaccagcaggacactgagcggagctacacccacctgggaacc
atggtggagtttgccatggctttggtagccaagttggacattatcaacaaacattcgttc
aatactttcaaactccgtgtgggtataaatcacggactggttgtggccggggtcatcgga
gctcaaaaaccccaatatgatatttggggaaacactgtgaatgtagccagtcgaatggag
agtacaggagttctggggaagatacaggtcacagaagagacggctaaagctttggcgaca
ttaggctacacttgctcccttcgtggggttatcaaggtcaagggcaaaggtgaactaaga
acttactttgtctgtacggaaacggctcgttcttgctcccaagcaccgatgttgagctaa

DBGET integrated database retrieval system