KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107287430Help
Entry
107287430         CDS       T05763                                 

Definition
(RefSeq) cytosolic phospholipase A2 epsilon-like
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur00564  Glycerophospholipid metabolism
pmur00565  Ether lipid metabolism
pmur00590  Arachidonic acid metabolism
pmur00591  Linoleic acid metabolism
pmur00592  alpha-Linolenic acid metabolism
pmur01100  Metabolic pathways
pmur04010  MAPK signaling pathway
pmur04217  Necroptosis
pmur04270  Vascular smooth muscle contraction
pmur04370  VEGF signaling pathway
pmur04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107287430
   00565 Ether lipid metabolism
    107287430
   00590 Arachidonic acid metabolism
    107287430
   00591 Linoleic acid metabolism
    107287430
   00592 alpha-Linolenic acid metabolism
    107287430
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107287430
   04370 VEGF signaling pathway
    107287430
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107287430
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107287430
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107287430
Enzymes [BR:pmur01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107287430
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2 ICAT
Motif
Other DBs
NCBI-GeneID: 107287430
NCBI-ProteinID: XP_015671430
Position
Unknown
AA seq 819 aa AA seqDB search
MVSRMGSLATFLKVPNSKTKFWENQESQHGVQAHVGFTESDCYVTLWLPTSSLEKFRTKT
VTNCKNPIWNEIFYFRIQSQVKNVLELTICDEDFYRNDDNRVIYFDVAKIPLGESIMVKF
ELDHLENELMEVEFTLENIEGPPETIATNGAVVCREFCRLEFQIDRKKRKKKKKYSKQQD
VKCTLKGSFEETQNISLTSANKLQCTGPSFFHYAKYNPAKLDILLPGKRSFLSFFSCMCS
GIGAAKTRKLTLPIHSFPLNQEIIKEDKEFNLHFTTQNCTSDLDVRLGFDLCPEEEAFLK
KRKKVTAAAFKKILQLEDDLEEDEVPVVAIMTTGGGIRALTAMYAHLLTLQKLNVLDCVS
YLTGLSGTTWTMACLYEDPNWSQNDLEKPLRDLQNQVTKNKFVASFAPKKLKYYAKELWQ
RYQEGYSVSFTDLWGLIIEALLNNEENPHKLSDQQQALSDGQNPLPIYLCLNVKEKLSNR
GFREWLEFTPYEVGFQKYGAYIRPEHFGSKFFMGRLMEKIPESRICFLEGIWSSVFSVNI
MDGWYQATTSEDFWQIWTRDRITDLKELTGCPETYKLPVRVQCPPGSLASIFQDIIMWRP
AVSLIPNFLRGCPMHNKYLESGFANWKDCDLDSFPNQLIGSEEHLYLVDNAFALDTSYPP
LTRPERKVDLFIHLNYSSGSQLLPLQMASDYFSEQGIPFPRIIPQEQDEKDVKECYLLGE
QEGPNIPLVLLYPLVCNTFQNYKEPGVKRSPEEMNDGDIDVTSTFGPYNVYTLEYSDEDF
EKLVKLSQYNIQNNKNTLIDALRLAVERKKQYKKNLHML
NT seq 2460 nt NT seq  +upstreamnt  +downstreamnt
atggtttctagaatgggatcacttgctactttcctgaaggttccaaacagcaaaacaaaa
ttttgggaaaatcaagagagtcaacatggtgttcaagcacatgtaggattcactgaatct
gattgctatgtgaccttgtggcttcctacttcctcactggaaaaatttcgaaccaaaact
gttacaaactgcaaaaatccaatatggaatgaaatattctatttcaggatccagagtcaa
gtcaagaatgttttggaactgacaatatgtgatgaagatttctatcgaaatgacgacaac
cgtgtaatttactttgatgtagctaaaatcccacttggagaatcaataatggtaaaattt
gaattagatcacctggaaaatgaattaatggaagttgaatttacattggagaatatagag
ggtccacctgaaacaatagctacaaatggagcagtggtgtgtcgtgaattctgccgcttg
gagtttcagatagacaggaagaagcggaagaaaaagaaaaagtattctaaacaacaagat
gttaaatgtacattaaaaggatcctttgaagaaactcaaaacatttcattaacttctgcc
aacaagctgcagtgcactggaccttcctttttccactatgccaagtataatccagcaaaa
ctggacattcttcttccaggaaagagatcgtttctctcttttttctcttgcatgtgttct
ggaattggtgctgccaaaaccagaaagttgaccttgcctatacattcatttcccctaaat
caggaaataatcaaagaggataaagaatttaatttacacttcacaacccagaactgcaca
tcagatctagatgtacgcttagggtttgatctttgtccagaagaagaggctttcctgaaa
aaacgaaagaaagtgactgctgctgctttcaaaaagattctccagcttgaggatgatctg
gaggaagatgaggtgccagtggtggcaatcatgacaacaggcggtgggatcagagcactt
acagcgatgtatgctcacctactgacattgcagaaattaaatgttttggactgtgtgtcc
tatctcactggattgtctggcacaacatggacaatggcatgcttgtatgaggatcccaac
tggtcccaaaatgatttagaaaagccactcagggatttgcaaaaccaggtgacaaaaaat
aagtttgtggccagttttgcccccaaaaaattgaagtactatgcaaaggaactgtggcaa
cgttatcaagaagggtacagtgtatcttttacagatctatggggattgattattgaagct
ctgctaaacaatgaggagaaccctcacaaactttcagatcagcagcaggccctatctgat
ggacagaatcctctacctatatatctttgcctcaatgtgaaagagaaactaagtaatcga
ggctttagagaatggttggaattcacaccatatgaagttggattccaaaaatatggtgcc
tacattcgtcctgaacactttggtagcaagttcttcatgggacgcttgatggagaaaatc
ccagaatcacgtatctgctttttagaaggaatctggagtagtgtgttttctgtgaacatt
atggacggctggtaccaggctaccacttcagaagatttttggcagatatggacacgagac
agaataactgatttgaaagaacttactggttgtccagaaacgtataaactacctgttcga
gtccagtgtcctccaggaagccttgccagcatttttcaagatattattatgtggcgacct
gctgtgtcattgatccccaattttctaagaggctgtccaatgcacaacaaatatttagag
agtggatttgcaaactggaaagattgtgatcttgacagttttcctaaccagctaattgga
tctgaagagcatctgtatctggtggataatgcatttgccctcgacaccagctatccccca
cttacgaggccagagagaaaagtggatctcttcatacatttaaattatagctcaggttca
caattactgcctctgcaaatggcctcagattatttctcagaacaaggaattccttttcct
agaattatcccacaggaacaagatgaaaaagatgtaaaggaatgctatttgctaggagaa
caagaaggtccaaatattccattagttctcctttaccccctggtttgtaataccttccaa
aattataaagaacctggtgtgaagcgtagtcctgaagagatgaatgatggtgatattgat
gtgacaagtacctttggtccttataatgtttatactttggaatattcagacgaagatttt
gagaaactagtaaaactgagccagtacaacatccaaaataacaaaaatactttgattgat
gctttacggttagctgtagaacggaaaaaacagtataagaagaaccttcatatgctgtga

DBGET integrated database retrieval system