KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107288323Help
Entry
107288323         CDS       T05763                                 

Definition
(RefSeq) carnitine O-palmitoyltransferase 1, liver isoform isoform X1
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur00071  Fatty acid degradation
pmur01212  Fatty acid metabolism
pmur03320  PPAR signaling pathway
pmur04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107288323
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107288323
   03320 PPAR signaling pathway
    107288323
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N NIF3
Motif
Other DBs
NCBI-GeneID: 107288323
NCBI-ProteinID: XP_015672416
Position
Unknown
AA seq 771 aa AA seqDB search
MAEAHQAVAFQFTVTPDGIDLRMSHEALRQIYLSGLYSWKKKFIRFKNGIITGVYPASPS
SWLIVVVGVMSTMYAKIDPSLGLIAKINQTLDTTGYMSNQTQNIVSGILFGTGLWVTLIF
SMRYSLKMLLSYHGWIFAEHGKMSTRNKIWMALVKLFSGHKPMLYSFQTSLPRLPVPAVK
DTVNRYLESVRPLMNNEEFKRMEGLGKDFAVNLGPKLQWYLKLKSWWATNYVSDWWEEYI
YLRGRGPIMVNSNYFAMDFLYFTPTTMQAARAGNAIHAILMYRRKLDRQQIQPILLMGST
VPLCSAQWERMFNTSRIPGNETDTIQHLKDSKHIAVYHKGRYYKVWLYYDGRLLKPREIE
QQMQWILNDKSEPQPGEEKLAALTAGDRVPWAKARQTYFARGKNKQSLDAIEKAAFFVTL
DDTAQGYREEDPVTSMDAYSKALLHGKCYDRWFDKSFNLIVFRNGKMGLNNEHAWADAPI
VGHLWENVMFSDCLELGYTEDGHCKGEATLGIPMPTKLQWEIPKECQEVIEKSLNIIARP
LADDVDFHSFLFDAFGKGLMKKTKTSPDAFVQLALQLAHYRDMGKFCLTYEASMTRLFRE
GRTETVRSCTVQSCKFVQAMEDPNETPEKKCMLFKAAAGNHQCLYRLAMTGAGIDRHLFC
LYVVSKYLVVESPFLKEVLAEPWRLSTSQTPQQHIDLDKNPGMESSGGGFGPVADDGYGV
SYIITGEDLINFHVSSKFSCIETDSHRFGKNIQQALCDIRDLFHLGKNSTK
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagcccatcaagcagttgcgtttcagtttacagtaacgccagatggaattgat
ttgcgcatgagccatgaagcgcttaggcagatctatctatctgggctctattcctggaaa
aagaagttcatcagattcaagaatggcataatcacaggagtctatcctgctagcccatcc
agttggctcattgttgtagtaggagtaatgtcaactatgtatgcaaaaatagatccttcg
ctgggattaatagctaaaatcaaccagaccctggatacaactggctatatgtccaaccaa
acacagaatattgtcagtgggattctgtttgggacagggctatgggtgactcttattttc
tcaatgcgctactctttgaaaatgctgctttcgtaccatggttggatatttgcagagcat
ggaaaaatgtctacaagaaacaagatatggatggcacttgtgaaacttttttctggtcat
aaaccaatgctgtacagctttcagacctcactaccacgccttcctgttccagctgtaaag
gatactgtaaataggtatttagaatcagttcgtccacttatgaataacgaagaatttaaa
agaatggaaggtcttggcaaagattttgctgtaaatctgggaccaaagctacagtggtat
ctgaagttaaagtcttggtgggctacaaattatgtcagtgattggtgggaggaatacatt
tatcttcgaggacgtgggcctattatggtaaacagcaattactttgccatggattttctg
tattttacaccaactactatgcaggcagctagagctggcaatgccatccatgctatcttg
atgtatagaagaaaactggatagacagcaaatccagccaattcttctgatgggatccact
gttccactctgctcagctcaatgggagaggatgtttaacacctcccgtattccaggaaat
gaaacagacactatccagcatttgaaagacagcaaacatattgctgtatatcataaggga
cgctattacaaagtatggttgtactatgatggcagactcctaaaacccagggagattgag
caacagatgcaatggatcctaaatgacaaatctgagcctcaaccaggtgaagagaagtta
gcagctcttactgctggagacagagttccttgggctaaagctcgccaaacatattttgca
agaggaaagaacaagcagtcattggatgcaattgaaaaggctgctttctttgttactttg
gacgatactgctcaaggttaccgagaagaagatccagttacatcaatggatgcatattca
aaagcacttctacatggcaaatgctatgacaggtggtttgacaagtcgtttaatctcata
gtgttcagaaatggtaaaatgggcctgaataatgaacacgcttgggcagatgccccaatt
gtcggacatctttgggagaatgtcatgttttctgattgtcttgaattgggatacacagaa
gatggacactgcaaaggggaggccactctaggcattcccatgcctaccaagctgcagtgg
gaaatccccaaagagtgccaagaagtgattgagaagtcccttaacattattgcaaggccg
ttagcagatgatgtggattttcattcttttctttttgatgcatttgggaaaggattaatg
aagaaaaccaaaaccagtcccgatgcatttgtgcaacttgctttgcaacttgctcattat
agggacatgggaaaattttgcttaacatacgaagcatctatgacccgcctatttagagaa
ggcagaacagaaacggtccgttcatgtactgtccagtcctgcaaatttgtgcaagctatg
gaagacccaaatgaaactcctgaaaagaagtgtatgctattcaaagctgctgcaggtaat
catcagtgtttatatcgcctggccatgactggtgctggcattgatcgtcaccttttctgc
ctttatgtggtctccaaataccttgttgttgaatcaccttttctaaaagaagttttggca
gaaccctggagactttcaacaagtcaaacacctcaacaacatattgatctggataagaat
cctggaatggaatccagtggtggaggctttggacctgttgctgatgatggttatggagtg
tcttacattattacgggtgaggatctcatcaacttccatgtatccagtaaattttcatgt
attgaaacagattctcatcgctttgggaaaaacatccaacaagcattgtgtgatatccgt
gacttgtttcaccttggcaaaaactctacgaaatga

DBGET integrated database retrieval system