KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107288516Help
Entry
107288516         CDS       T05763                                 

Gene name
ESPL1
Definition
(RefSeq) separin
  KO
K02365  separase [EC:3.4.22.49]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur04110  Cell cycle
pmur04114  Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107288516 (ESPL1)
   04114 Oocyte meiosis
    107288516 (ESPL1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pmur01002]
    107288516 (ESPL1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pmur03036]
    107288516 (ESPL1)
Enzymes [BR:pmur01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     107288516 (ESPL1)
Peptidases and inhibitors [BR:pmur01002]
 Cysteine peptidases
  Family C50: separase family
   107288516 (ESPL1)
Chromosome and associated proteins [BR:pmur03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Separase
    107288516 (ESPL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C50 CHAT DUF2515
Motif
Other DBs
NCBI-GeneID: 107288516
NCBI-ProteinID: XP_029140218
Position
Unknown
AA seq 2190 aa AA seqDB search
MKFLKNVDFVAQTNTPQETLTLLSLLKECLIFGPKNADCPNEASMQTTACDRILRACIYQ
FGESLDCPDHLKSLQALADMAYQGYVSARLQYVPLYLERLLYHLLRGVAAQGPSDTCLRF
ADLLYADLLKHQPPQVPVDDYTSIAKSAFSVLWMTTDAIAKMEKMPAEFKLALSTQLQAV
RFLLLLEHHSPNILLLEPPFLTSIVARHAAAAAVSFVARYSPLKKEEASFLNEQLFHLLV
AAILEKNGVSEPLPFQDCLCIFELMVVRVRYLCKTGCFRQSKEVIQQSKSFLRKSSNESH
CLRLTLDILLAGVELNKALLVAKSPVGPFFNQAAEVLNCSMDAQEPLLKVLAESGQLLVT
PLYEHAKKDKQKIFHLHDILEVSTFMESYFRLLCKLLNMVPKDNVKQQQVLVKLLYHYFQ
LYTTVVYDSFQMLPGLDFCGLPQLLASFQRIATQMLEMLEGLPKAEQAEYLDLSAYCVSR
LAYRFYSHKMYVESNSIMGQFCGWLVKKAKCTDLPTEKLHNCFKLQVENYRKLGLLEEGL
QTVALWLASHHNKITEQVVEPVCSWVKVKMDANKNGADDLRLKTLKEGLEEYHLDDEILV
KVLLEELKTYKTVRVDTGQERFNVICDLLDICSEGSQWVHERAFILVELAQVLCYHDYNE
QTECSALDSINEALQLLEYVPKSPQNEEQLQDDKAQALLWLYICTVEDKMHESIKQEQRT
RNTDTKVLQSFETNDLTYEDKSHDDKFLYLGIAFNLCADSVQSRCLDDALALWKQLLSKG
RTPSVRSIEQTAASLHIMAALYRMMGKPLEAIESFFLITALSDALKDFVGKTSALCQIVK
LLLQLECPSYAETLLREAELCLKNVDGNNSSYSLMNQTLAVLHSKLYLANCKIEEGLNLL
VGILQNPALQRSSKVWYLLRASALQLTAAYLILPSSILPLTLRQKLSVQGWKTPETALSD
AHRLYRSILLTFSLITSDASTKESLEHPFIDHGDNLVQKWQVLADMFVCSERFVSLLSKI
ETVSEAKAFCLETLKISMKVQSIRWCACFLVLKSELELQRNNLDLCASDLEQVSFLLESG
TVFETKEGKEKVKIKPKKGGPKGKKPKSLQLESPEEEQSFLKEACLEFIDTVPVQKTLTT
SPVLRPKLKKQPSFLNHSDKCCCLLCSDVFLSTICLRWLIISVDGELTFGNRVEGFHLLE
AILQRCATVARRIAHVVAHVSQQEEKKVVGPCQSTIGLLDGLVAHTYVLLTKQSMNSRTP
GKKLWQFLEKGLTFLSSKGPQLLELEYYRAQLLIARAVAAISVLTSRQDSYTENILSSTW
SWKSPMPLTGDQEIKQGTTTEETFNTIYEMSRKSRTKKQPGLVSKSKPKRIQGTKSRPVV
NPNDPFALGDSDSDTPFIVLKPPTESFCTPAQKSLPVSKKNLSLSARSITTHKAPFVVFE
ESSPKLTTELPKAPKVTRRMKCRIKIPFSDDSDAEGHPEAGPESQLCVENEPMAATRRTG
RRLASNRKPAKIEKCSAGSSQECSKMVNPQLGRPSTRRRTRQEKQEEIQKASKEKIHQED
QGGGEKKEILKTNKESSEDNIEVLRGSDEKPVKETRGQPRTEDQEVLRRDFGTVLQGGFS
ATEKKVLEDPFNLHVLASSLDAPADILSMDSVYDSLQAAFHSIAHYPLGALYNHLCQLMA
LCIGNRDPIATAYLVSESVSITLRHQKMTMIHKKLNKMKKTSVAKQLEALTLQEGKADSQ
LQHLLELQNAFEFSCPNSTELETKKFREGLQEIPPGVTVCIMTLVSTQPETMGDILLLTR
LEKGAIPVNIQIQTLHAKVSLSAALSEFEAILQKQKEISNFTEKEDWWTGRIALDKRMMA
LMDSLEIHVLSCWKIALLPTCENDSLMEEASHLLTHLRECGCEKVDIALLKVILAGSHLL
TPQLVEHLVRGLHPAQPERALSLLQETVDKLKLYTGQAPRGHLVLVLDKHLQKLPWENIP
CLRNQSITRLPSLHFLLSYSLMKKYQEETILNHGVSSSSTFYVLNPHKNLPGTEKMFKEW
FQSEPGWAGVVGEVPSTDQVPLALEERDLYIYAGHGAGARFVDSILKMDCRAVALLFGCS
SAALAVQGNLEGTGAILKFIMAGCPLVLGNLWDVTDRDIDRYMRALLNNWLKASSGAPLL
QYVIESRQAPKLRYMIGAAPIAYGLPVFLK
NT seq 6573 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcctcaaaaatgtggattttgtggcacagactaatactccgcaagaaactctg
actttattgtcactgctgaaggaatgcctcatatttgggcctaaaaatgcagactgtcca
aacgaagcttccatgcaaacaacagcatgtgatcggatccttcgggcttgcatctaccag
tttggagaaagcttggactgccctgatcatttaaaaagcctccaggccctagctgacatg
gcttatcaaggctacgtatctgcaagacttcaatatgttcctctctatttggaaaggcta
ctctatcacttactgcggggagtggctgctcaaggcccatctgatacttgcctgaggttt
gctgatcttctctatgcggatctgttgaagcaccagcctccccaagtgcctgttgatgac
tatacctctattgccaaaagtgcatttagtgtgctgtggatgaccacagatgccatagcc
aaaatggaaaaaatgcctgctgagtttaagcttgcactctccacccagctacaagcagtg
cggtttttactgctcctggagcatcattctcctaatattttgctcctagaacctccattc
ttaacttccatagtggcccggcatgctgcagctgccgctgtttcttttgtagcccggtac
agccctctgaagaaggaagaagccagctttctcaacgagcagctttttcatctcttggtg
gcagccattttggaaaagaatggtgtaagtgagcctttgcccttccaggactgcctctgt
atctttgagcttatggtggtaagagtacgttacctctgcaaaactggctgcttcagacag
agcaaagaagttattcagcagtctaaaagcttcttgagaaaatccagcaacgagtcccat
tgcttaagactcactttagacattctcttggctggtgttgaactgaataaagcactgtta
gttgccaaaagtcctgtaggccctttcttcaaccaagcagcagaagttctaaactgttct
atggatgctcaagaacccctccttaaagtgctggctgaaagtggccagttgcttgtaact
cctttatatgaacatgcaaagaaagataaacagaagatttttcatttgcatgatatcctg
gaggtttctacattcatggaaagttatttcaggctgctctgcaagctgttaaatatggtt
ccaaaagacaatgtgaaacagcaacaagttctggtgaaactactgtatcattatttccaa
ttatacacaactgtggtgtatgattcttttcagatgcttccggggttggatttttgtggg
ctgccacagttattggcatcttttcaaaggattgctacccagatgctagaaatgctggaa
ggactccctaaggcagagcaggccgaatatctggatctctcagcatactgtgtatcccga
ttggcctatagattctattctcataagatgtatgtagaatctaactccataatggggcaa
ttctgtggatggctagtcaaaaaggccaaatgtacagacttgcccacagaaaagctacac
aactgctttaagctgcaagtagaaaactacaggaaactgggcttgctagaggagggtctt
caaactgtagccctctggttggcttctcatcacaacaagatcacagaacaggtggtggag
cctgtctgctcctgggtcaaagtcaagatggatgccaataaaaatggggctgatgatttg
aggctgaagactctgaaggaaggtcttgaagagtatcacttagatgacgagatccttgtg
aaagtcctgttggaggaactaaagacatacaaaactgtgcgagttgacactggccaagag
cgtttcaatgtgatctgtgacctcctagatatatgttcagaaggcagccaatgggtccat
gaaagagcttttatcctagtagaattggcacaggtgctgtgttatcatgattataatgaa
cagacagaatgttctgctctggactctataaatgaagccctgcagttgttagaatatgta
ccaaagagtccacagaatgaggaacagctccaggatgataaggcccaggctttactctgg
ctttatatctgcacagttgaggacaaaatgcatgagagtatcaagcaagagcagagaacc
agaaatactgatacaaaagttcttcagagctttgaaaccaatgatctcacttatgaggat
aaatcccatgatgacaagttcctgtatcttggcattgcatttaatctatgtgcagattct
gtgcaatccagatgtttggatgatgccctggccttatggaaacagctcctatcaaaaggc
aggaccccatcagtacggagcattgagcagacagcagcatccctgcatatcatggcagct
ttatacagaatgatggggaagccactagaggctatagagagcttcttcctcataacagct
ctttctgatgcacttaaagattttgttgggaaaaccagtgccttgtgccaaatagttaag
ctccttctccagctggagtgtcccagttatgctgagactcttttaagggaagctgaacta
tgcctgaaaaatgtggatggaaataatagctcctactcgctgatgaatcaaacattggct
gtgctccatagcaagctgtatttagcaaactgcaagattgaagaaggcctcaatctatta
gtaggaatccttcaaaatccagctttgcaaagatcctccaaggtctggtatctgctgcga
gccagtgctctccagctaactgctgcttatcttatcctaccttcttccattctcccactg
acactccggcaaaagctctctgttcaaggatggaagacgcctgaaacggctctaagtgat
gcacacagactgtaccgtagcatcctcttgaccttttcactcattaccagcgatgcatca
acaaaagagtctcttgaacatccgtttattgatcatggtgataacctggtgcagaaatgg
caagtgctggcagatatgtttgtttgttcagagcgttttgtgtctctccttagcaagatt
gagactgtaagtgaagccaaagctttctgcctggaaacactcaaaatttccatgaaggtg
cagtccattcgatggtgtgcttgctttctggttctgaagagtgagctggagctccagcgc
aacaatctggatctatgtgcctcagatcttgagcaggtctcctttcttcttgaatcgggc
acagtgtttgaaaccaaagaaggaaaggagaaagtgaaaatcaagcccaagaaaggaggc
cctaagggcaagaagcccaaaagcctgcagttggagtctcccgaggaagaacagtcattc
ttgaaagaagcctgccttgaattcattgatacagtccctgtgcagaagactttaactact
tcaccagtactgaggccaaagctgaagaaacagcccagcttcctgaaccactcagataag
tgctgctgtttgctatgttctgatgtgttcctctccaccatctgcctccgctggttgatc
atctctgtagatggagagctgacctttgggaatagagtggaaggatttcatctccttgag
gccattctgcaaagatgcgccactgtggctcggcggatcgcccatgtggtagcacatgta
tctcagcaggaagagaagaaagttgttggtccatgtcaatccaccattgggctccttgat
ggtctcgtggcccacacctacgtgctactgacaaagcaaagcatgaacagcaggacacca
gggaagaaactctggcagtttctcgagaaggggttgacctttctttcctccaaggggcct
caactgcttgaacttgaatactacagggcccaactactaattgccagagctgtggctgca
atttctgttctcacctccagacaagacagttatacagaaaatatcctgtctagtacttgg
tcgtggaagtccccaatgcctcttactggagaccaagaaatcaagcagggaacaacaaca
gaagagactttcaatacaatttatgaaatgtctcggaaaagcagaacaaagaagcaacca
ggacttgtctcaaaatcaaagcctaagagaatccaagggaccaaatctcggcctgtggtc
aacccaaatgacccctttgcccttggtgactctgattcagacactcctttcattgttctt
aagccccctactgaatccttctgtaccccagcacaaaaatcccttccagtctccaagaaa
aacctgtccttaagtgccaggtccatcacaactcacaaggctccatttgtggtgtttgag
gaatcctctccaaaactgaccactgaacttccaaaagctcccaaagtaaccaggagaatg
aaatgccgaattaagattcccttcagcgatgacagcgatgctgaaggccatccagaagca
gggccagaatcccagctctgtgttgagaatgaaccaatggctgctactcgcaggacagga
cggagactagcatctaacagaaaaccagctaaaatagagaagtgcagtgctgggtcttca
caggagtgctccaaaatggtaaatccccagcttgggaggccaagtactaggagacgcact
agacaagaaaagcaagaagaaatccagaaagcttccaaggagaaaattcatcaggaagat
caaggaggaggagaaaagaaagagattctaaagacaaacaaggagagttcagaagacaac
attgaagtcttgcgaggttctgatgagaaacctgttaaagaaactcgaggacaaccaagg
acagaagatcaggaggtccttcggagagactttggcactgtcttacagggaggattttca
gctacagagaagaaagttttggaagatcccttcaacttgcacgtacttgcctcttcgcta
gatgcaccggctgacatcttgtccatggactcagtctacgactccctgcaagccgctttt
cattcaattgcccattatccactgggtgccctctacaaccatctctgtcaactcatggcg
ctgtgtattgggaaccgggaccccattgctactgcctatctggtttctgagtcagtctct
atcactcttcgtcatcagaagatgaccatgattcataaaaagctcaacaaaatgaaaaaa
acatcagtggccaagcaactggaggcactcaccctgcaagaaggaaaagcagattctcag
cttcagcacctcttagaacttcagaatgcctttgagttcagttgccccaactcaacagag
ttggaaactaagaaattcagagaagggctgcaggaaatcccccctggagtcacagtgtgc
ataatgactctggtgagcacccagccagagaccatgggggacatcctcttattgacaagg
ttagagaaaggtgctatccctgtgaacatccagatacagactctgcacgccaaggtctcc
ttaagtgcagctctaagtgaatttgaagccatcctgcaaaaacaaaaagagatctcaaat
tttacagagaaagaggattggtggactggccggatagcattggacaaaagaatgatggct
ttgatggattctctggagatacatgtgctgagctgttggaagattgcactactaccaacc
tgtgaaaatgacagcttaatggaagaagcctcccatcttctaacacatctcagagaatgt
ggttgtgaaaaggttgatatagctttgctcaaggtcatactggctggatcccatttgtta
actccacaacttgtagagcacttggtacggggccttcacccagctcaacctgagagagcc
ctgagccttctacaggagacagtggacaaactgaaattatacactggccaggcaccaagg
ggccacttggtgcttgtgctggataaacatctccagaagcttccctgggaaaacatacca
tgtttaagaaaccagtcaataacccgattaccatctctacactttctgcttagctactca
cttatgaaaaagtatcaggaagagactatcctcaaccacggagtcagcagcagcagcacc
ttctatgttctgaacccacacaaaaatcttcctggcacagagaagatgttcaaagaatgg
tttcaaagtgaacctggatgggcaggagtggtgggagaggttcccagtacagaccaagta
ccactggccctcgaagaacgtgatctctacatctacgctggccatggggcaggcgcacgc
tttgtggattccatcttaaaaatggattgcagagctgtggctcttctttttggctgcagc
agtgctgctctagcagtacagggcaacctggagggaactggtgctatcctcaagttcatc
atggcaggatgtcccctagtgctgggtaatctctgggatgtaacagatcgagatattgat
cgctatatgcgggcacttctgaacaactggctcaaggcaagttctggagcccctttgctg
cagtacgtcattgaatcccgccaggctcccaagctcagatacatgattggagctgctccc
attgcatatggcttaccagtattcctgaaatag

DBGET integrated database retrieval system