KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107289217Help
Entry
107289217         CDS       T05763                                 

Gene name
CPT1B
Definition
(RefSeq) carnitine O-palmitoyltransferase 1, muscle isoform
  KO
K19523  carnitine O-palmitoyltransferase 1, muscle isoform [EC:2.3.1.21]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur00071  Fatty acid degradation
pmur01212  Fatty acid metabolism
pmur03320  PPAR signaling pathway
pmur04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107289217 (CPT1B)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107289217 (CPT1B)
   03320 PPAR signaling pathway
    107289217 (CPT1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pmur03029]
    107289217 (CPT1B)
Enzymes [BR:pmur01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     107289217 (CPT1B)
Mitochondrial biogenesis [BR:pmur03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    107289217 (CPT1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N
Motif
Other DBs
NCBI-GeneID: 107289217
NCBI-ProteinID: XP_015673409
Position
Unknown
AA seq 774 aa AA seqDB search
MAEAHQAVAFQFTVTPDGVDFRLSQEALKQIYLSGLHSWKKRFIRLKNSFLTGVYPGSPS
GWLAITAVTVGSTWVHVDLSRGVISSIQRHLPTSCSCYFNLRQQTLLSALLFSTGLWILG
IWLRRQMLKLLLSYHGWMFEPHGKTSFSTKAWVALVKVMSGRHPMLYSFQTSLPKLPVPS
VEDTVRRYLDSVQPLLDKEKYEQMEALARDFQQKLAPRLQRFLLLKSWWATNYVSDWWEE
YIYLRGRGPIMVNSNYYLMDFLYITPTPIQAARAGNCVHAILKYRRQLDREELEPVMALG
VVPMCSYQMERMFNTTRIPGKEADSLLHLVDSRHLAVFHRGRFFKVWLYQAGKQLPPRDL
EMQFQRILDDPSPPLPGEQRLAALTAGSRVPWAEARAKFFSRGKNRASLDCIDRAAFFLA
LDEEAQGYSPEREESLSDYAKSLLHGHCNDRWFDKSFTLVVYQNGKLGGNAEHSWADAPV
MGHLWEFMLAADQLQLGYCNGGHCQGVPNTDLPPPQRLVWDLPEECIQTIDASYGEAQAL
ADDVDFCCFCFSTFGKGLIKKGRTSPDSFIQIALQLAHFRDRGHFCLTYEASMTRLFREG
RTETVRSCTSEATAFVLSMSDPNCSPLDRLQLFRAAAEKHQQMYRLAMTGAGIDRHLFCL
YVMSRYLGEKSPFLDKVLSEPWRLSTSQTPQQQIKMLSLEAYPDYVSSGGGFGPVADDGY
GVSYIIAGENLITFHISSKFSSPETDSTRFGKNIRQAMVDIAALLDVQPRRVAR
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagcccaccaggccgtcgccttccagttcacggtcaccccagacggggtggac
ttccggctgagccaggaagcgctgaagcagatctacctgtcgggcctccattcttggaag
aaacggttcatccggctgaagaacagcttcctgaccggggtgtatcctggctccccctcc
ggctggctggccatcaccgccgtgaccgtgggcagcacgtgggtccacgtggacctctcc
cggggggtgatcagcagcatccagaggcacctgcccaccagctgcagctgctacttcaac
ctccgccagcagaccctgctcagcgccctgctcttctccaccggcctctggatcctgggc
atttggcttcgccgccagatgttgaagctgctgctctcctaccacggctggatgttcgag
ccccacggcaagacgagcttcagcaccaaagcctgggtggccctggtgaaagtcatgtcc
gggcgccaccccatgctctacagcttccagacctccttgcccaagctgccggtacccagc
gtggaggacaccgtccgtaggtacctggactctgtgcagcccctgctggacaaggagaag
tacgagcagatggaggccctggccagggacttccagcagaagttggccccccgcctccag
aggttcctgctcctcaagtcctggtgggccaccaactatgtgagcgactggtgggaggag
tacatctacctgcgggggagaggccccatcatggtcaacagcaactactacctcatggac
tttctctacatcacccccacgcccatccaggcagcccgagccggcaactgcgtccatgcc
atcctgaagtaccgtcgccagctggaccgggaagagcttgaacccgtgatggcgctgggc
gtggtgcccatgtgctcctatcagatggaacggatgttcaacacaacgcgcatccctggc
aaagaggcagactccctgctgcacctggtcgacagccggcacctggccgtcttccaccga
gggcgcttcttcaaagtgtggctgtaccaggcggggaagcagctgcccccccgggacctg
gagatgcagttccagcgcatcctggacgacccctcccctccgctgcccggggagcagagg
ctggcggccctcaccgcagggagcagggtcccctgggccgaggcccgtgccaagttcttc
agccggggcaagaaccgggcctcgctggactgcatcgaccgggccgccttcttcctggcg
ctggacgaggaggcgcaaggctacagccccgagcgggaggagagcctgagcgactacgcc
aagagcctcctgcacgggcactgcaacgaccggtggttcgacaagtccttcacgctggtg
gtctaccagaacggcaaactggggggcaacgccgagcactcgtgggccgacgcccccgtc
atggggcacctctgggagttcatgctggcggcagaccagctccagttgggttactgcaat
ggcgggcactgccaaggggtgcccaacaccgatctgccccctcctcagcgtttggtctgg
gaccttccagaagagtgcatccagaccatcgatgcctcctacggcgaggcccaggcgctg
gccgatgacgtggacttctgctgcttctgcttctccactttcggcaaagggctcatcaag
aaaggccggaccagccccgacagcttcatccagatcgccctgcagctggcccacttccgg
gacaggggccacttctgcctcacctacgaggcctccatgacgcggctcttccgcgagggc
cggacggagacggtgcgctcctgcaccagcgaggccacggccttcgtgctcagcatgagc
gaccccaactgcagccccctggaccgcctgcagctcttccgggcggcggccgagaagcac
cagcagatgtaccgcctggccatgacgggggccggcattgaccggcatctcttctgcctc
tacgtgatgtcgcgctacctcggggagaagtcgccctttctggacaaggtgctgtccgag
ccctggcgcctctccaccagccagaccccccagcagcagatcaagatgttgagcctggag
gcctatccggactacgtctcctccggcggaggctttgggccggtggctgacgatggctac
ggggtctcctacatcattgccggcgagaacctgatcacatttcatatttccagcaagttc
tccagccccgaaacggactccacgcgtttcgggaagaacatccgtcaggccatggtggac
attgccgctctgctggacgtgcagcccaggcgagtggcccgctga

DBGET integrated database retrieval system