KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107289602Help
Entry
107289602         CDS       T05763                                 

Gene name
ALDH5A1
Definition
(RefSeq) succinate-semialdehyde dehydrogenase, mitochondrial
  KO
K00139  succinate-semialdehyde dehydrogenase [EC:1.2.1.24]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur00250  Alanine, aspartate and glutamate metabolism
pmur00650  Butanoate metabolism
pmur01100  Metabolic pathways
Module
pmur_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    107289602 (ALDH5A1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    107289602 (ALDH5A1)
Enzymes [BR:pmur01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     107289602 (ALDH5A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 107289602
NCBI-ProteinID: XP_015673871
Position
Unknown
AA seq 501 aa AA seqDB search
MASPSPSRLRSTGPGLATGAASLARSGGFVGGRWLQAAATFPVRDPATGAELLQVADCGV
AEAEAAVKAAYEAGATWSAASAKDRAVLLHKWYDLMIENKDELARIITAENGKPLKEAEG
EILYSASFLEWFAEEARRIYGDIIPSSAKNRRVLVLKQPVGVAAIITPWNFPSAMITRKV
GAALAAGCTVVVKPAEDTPLSALALAELANQAGIPAGVYNVVPCSRQQAAAVGEVLCTHP
LVAKISFTGSTATGKVLLCHAAGTVKRVSMELGGHAPFIVFDSADVDKAVAGALISKYRN
SGQTCVCANRFLVQKGIHDEFVKKFAQAIERELCIGHGFDEGTTQGPLINERAVEKVESH
IDDAVSQGASIITGGKRHSYGKNFFEPTLLCNVSTNMLCTQEETFGPLAPVIKFDTEEEA
LAIANSANVGLAGYFYSQDPGQIWRVAEKLEVGMVGVNEGIISSVECPFGGVKQSGLGRE
GSKYGIDEYLEIKYVCLGGLQ
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcccgtcgcctagccggctgagaagtaccggcccaggcttggccactggggcc
gcttccctggcccgctctggaggcttcgtgggaggccgctggctccaggcggcagccact
ttccccgtgcgggacccggccaccggcgcggaactcctccaggtagcggactgcggcgtg
gcggaggcggaggccgcggtgaaggccgcctacgaagccggcgcaacttggagcgcagct
tctgcaaaggatagagcggttttgcttcataaatggtatgatttgatgatagagaataaa
gatgagcttgcaaggatcattacagcagaaaatggaaaaccactgaaggaagccgaaggg
gaaatcttgtattcagcttctttcttggaatggtttgctgaagaagcccggcgtatttat
ggtgatattattccatcttcagcaaaaaacaggagagtccttgttttgaagcagcctgta
ggagttgcagccatcattacaccttggaattttccaagcgctatgattacccggaaagta
ggtgctgctttggcagctggctgtacagtagtagtgaagccagctgaagacacaccttta
tctgccttagcactagccgagcttgcaaatcaggctggaatccctgccggagtatataat
gttgttccatgttccagacaacaggcagcagctgttggagaggtcctttgtactcatccc
ttggtagccaaaatctcatttactggctcaacagctacaggaaaggtattgctatgccat
gctgctggcacggtaaagcgggtttccatggagctcggaggccatgctcctttcatagtc
ttcgacagtgctgacgtagacaaagcagttgctggagctttaatttctaaatacagaaat
tcagggcagacctgtgtatgtgcaaaccgcttcttggtgcagaaagggatccatgatgaa
tttgtcaagaagtttgcccaagccattgagagggaactatgtattggccatggatttgat
gaagggactacccaagggccattaattaatgaaagagcagtagaaaaagttgaaagtcac
attgatgacgcagtgtcccaaggagcatccataattactggaggaaaaaggcacagttat
gggaaaaatttctttgagccaactctgctttgcaatgtgtcaacaaatatgttatgtaca
caagaggagacttttgggcctttggctccagttatcaaatttgatacagaggaggaagca
ctcgccattgcaaattcagccaatgtgggtttagcaggctatttctattctcaagacccg
ggccagatttggagagtcgctgagaagctggaagttggaatggtcggcgttaatgaaggg
attatatcttccgtggagtgtccatttggtggggtcaaacaatcagggctaggaagagaa
ggttctaaatacggtattgatgagtatttagaaataaaatatgtttgtttgggaggttta
caatag

DBGET integrated database retrieval system