KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107289632Help
Entry
107289632         CDS       T05763                                 

Definition
(RefSeq) L-amino-acid oxidase
  KO
K03334  L-amino-acid oxidase [EC:1.4.3.2]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur00250  Alanine, aspartate and glutamate metabolism
pmur00270  Cysteine and methionine metabolism
pmur00280  Valine, leucine and isoleucine degradation
pmur00350  Tyrosine metabolism
pmur00360  Phenylalanine metabolism
pmur00380  Tryptophan metabolism
pmur00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pmur01100  Metabolic pathways
Module
pmur_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    107289632
   00270 Cysteine and methionine metabolism
    107289632
   00280 Valine, leucine and isoleucine degradation
    107289632
   00350 Tyrosine metabolism
    107289632
   00360 Phenylalanine metabolism
    107289632
   00380 Tryptophan metabolism
    107289632
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    107289632
Enzymes [BR:pmur01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.2  L-amino-acid oxidase
     107289632
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_binding_2 FAD_binding_3 Thi4 Pyr_redox_2 FAD_oxidored Pyr_redox HI0933_like AlaDh_PNT_C Pyr_redox_3 2-Hacid_dh_C MCRA TrkA_N IlvN NAD_Gly3P_dh_N Shikimate_DH FMO-like Trp_halogenase ACAS_N 3HCDH_N GIDA Lycopene_cycl NAD_binding_7 DUF1917 DUF1188 ApbA NAD_binding_9 TypeIII_RM_meth
Motif
Other DBs
NCBI-GeneID: 107289632
NCBI-ProteinID: XP_015673909
Position
Unknown
AA seq 487 aa AA seqDB search
LVLLLLLFLGVLRSESDVTNLEECFQDPEYEKWLDVARHGLGRNLKPKTVVIVGAGISGL
TAAKLLREAGHQVVILEASNRVGGRIKTHREKGWYIDVGPMRLPKTQRIVREYIDKFKLR
LHPFTQTDKNAWYLIQNVRQKMIFDDNEIFGYQLNPNERGKSADQLFEETLNKVTDNCTL
LKEKYDSFSTKEYLIKEGNLSRGAVEMIGDFLNEESGFHYSFLHSVIDHFVFSNNSFDEI
VDGFDQLPQSFFQEMVRTVHFNCTVEKILRTNNKVRVFYKWLTGSASLVADYVLITATAK
ATQLIKFAPPLSIPKTRALRSLMYASSTKIALVCTEKFWEKDGIRGGRSITDLPSRVIYY
PNHDFPHGIGVLLASYTWHSDSDFYTALSDEKCADVVMDDLVEIHQVSKNYLKSVCGKYV
VQKWTLDQYSRGAFSTYAPYQFAHYSEILAQNEGRIYFAGEHTSQPQAWIDTSMKTAIKA
AVNIHNA
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
ctagtactacttcttttattattcttgggtgtgctgagatcagaaagtgatgttaccaac
ctggaagagtgtttccaagatcctgaatatgaaaagtggctggatgttgccagacatggt
ctaggaaggaacttgaagcctaagacagttgtgattgttggagcaggaataagtggactg
actgctgccaaattactcagagaagctggacatcaggttgtgatcttggaagccagtaac
cgtgtgggaggacgcataaagacccaccgagaaaaaggctggtatatagatgtggggcca
atgcgattgcccaaaacacagagaattgtacgtgaatacattgacaagtttaaacttcgt
ctacatccattcactcagactgataagaatgcctggtatttaattcaaaatgtcagacaa
aaaatgatatttgacgataatgaaatctttggatatcaacttaaccccaatgagcgggga
aagtctgcagaccagctgtttgaggagacgctgaacaaggtcacagacaactgtaccctt
ctgaaggaaaaatatgattcgttttccacaaaggaatatctcattaaggaaggaaatttg
agcagaggagctgttgagatgattggtgacttcctgaatgaagaatctggatttcattac
tcattcctccattctgttatagatcattttgtcttttcgaataacagttttgatgaaatt
gttgatggatttgatcaacttcctcaaagtttcttccaggaaatggttagaactgtccat
ttcaattgcactgtggagaagatacttcgcacaaacaacaaagtgagagtcttctacaaa
tggttgacgggctctgcatctctggttgctgattatgtcctcatcacagctacagcaaaa
gccacacaactcatcaaatttgcgccacctctttccattcccaagacccgggcactgcgg
tctttgatgtatgcaagttctactaaaattgccttggtttgcactgagaagttttgggag
aaggatgggatccgaggagggagatcaatcacagatctcccatcgcgagtgatttactat
ccaaatcatgacttccctcatggaataggtgtccttctggcatcctatacttggcattct
gactctgatttctatactgcactcagtgatgaaaagtgtgctgatgtggtgatggatgac
cttgtggaaatccatcaagtatctaaaaattatctcaaatcggtttgtggcaaatacgtg
gtgcaaaaatggacccttgaccaatattctaggggagcattcagcacgtacgccccatat
cagtttgcccattattctgagatattggcccagaatgaagggaggatctattttgctggt
gaacacacgagtcagccacaggcttggattgacacttccatgaaaactgccataaaggca
gcagtcaatatccacaatgcataa

DBGET integrated database retrieval system