KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107289800
Entry
107289800         CDS       T05763                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur00230  Purine metabolism
pmur00240  Pyrimidine metabolism
pmur01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107289800 (DCK)
   00240 Pyrimidine metabolism
    107289800 (DCK)
Enzymes [BR:pmur01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     107289800 (DCK)
SSDB
Motif
Pfam: dNK AAA_18 Thymidylate_kin AAA_28 AAA_33
Other DBs
NCBI-GeneID: 107289800
NCBI-ProteinID: XP_015674101
Position
Unknown
AA seq 254 aa
MATPPKRSRGSVKKIAIEGNIAAGKSTFVNILKKAREEWEIVPEPVAKWCNVQDSHDDCE
ELTASQKSGGNLLQMMYEKPERWSFTFQAYACLSRIRAQLKSLEGKLKEAENAAVFFERS
VYSDRYIFASNLYESDCMNETEWTIYQDWHNWINQQFGSSLELDGIIYLRATPEKCLDRI
YIRGRDEEQGIPIEYLEKLHYKHESWLQYRTLRTEFEYLQGVPVLTLDVNEDFKGDRDKH
ENMIEKVQEFLSTL
NT seq 765 nt   +upstreamnt  +downstreamnt
atggcaaccccacccaaacgaagccggggcagcgtgaagaagatcgccatcgagggcaat
atagccgcaggcaaatctacctttgtgaatattctcaaaaaagcccgagaagaatgggaa
attgttccagagccagtggcaaaatggtgcaatgttcaggacagccatgatgactgtgag
gagctgacggcctcccaaaagagtggtggaaacctccttcagatgatgtatgaaaagcca
gagagatggtcctttacttttcaagcctacgcctgtctgagcagaatcagggctcagctc
aaatctcttgaagggaaactaaaagaagctgagaatgctgcggttttctttgagcgatca
gtttacagtgacaggtacatctttgcatccaatttatatgaatctgattgtatgaatgaa
acggaatggactatttatcaagactggcacaactggataaatcagcagtttggatcaagc
ctggaactggatggcattatttatctccgagctactcctgaaaaatgcttggataggatt
tacatccgcggaagggatgaagaacaaggcattcccatagaatatctggagaaactccat
tacaagcatgaaagctggctccagtataggacattacgaacagagtttgaatacttgcaa
ggggtacccgttctaacgctggatgtaaatgaagatttcaaaggcgacagagacaagcat
gaaaatatgattgagaaggtccaagaatttctgagtacactatag

DBGET integrated database retrieval system