KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107289939Help
Entry
107289939         CDS       T05763                                 

Definition
(RefSeq) heat shock 70 kDa protein II-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur03040  Spliceosome
pmur04010  MAPK signaling pathway
pmur04141  Protein processing in endoplasmic reticulum
pmur04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    107289939
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107289939
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107289939
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107289939
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pmur01009]
    107289939
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pmur03041]
    107289939
   03009 Ribosome biogenesis [BR:pmur03009]
    107289939
   03110 Chaperones and folding catalysts [BR:pmur03110]
    107289939
   04131 Membrane trafficking [BR:pmur04131]
    107289939
   03051 Proteasome [BR:pmur03051]
    107289939
   03029 Mitochondrial biogenesis [BR:pmur03029]
    107289939
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pmur04147]
    107289939
Protein phosphatases and associated proteins [BR:pmur01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     107289939
Spliceosome [BR:pmur03041]
 Complex B
  Other components
   Prp19 complex
    107289939
 Complex C
   Prp19-CDC5 complex
    107289939
Ribosome biogenesis [BR:pmur03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    107289939
Chaperones and folding catalysts [BR:pmur03110]
 Heat shock proteins
  HSP70 / DNAK
   107289939
Membrane trafficking [BR:pmur04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    107289939
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    107289939
Proteasome [BR:pmur03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    107289939
Mitochondrial biogenesis [BR:pmur03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    107289939
Exosome [BR:pmur04147]
 Exosomal proteins
  Proteins found in most exosomes
   107289939
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl DUF1464 FGGY_C HMG-CoA_red DDR Pox_D5 Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 107289939
NCBI-ProteinID: XP_015674252
Position
Unknown
AA seq 630 aa AA seqDB search
MPKQNDLAVGIDLGTTFSCVAVCQHDKVEIIANDQGKRTTPSYVAFTNTEHLIGDPAKSQ
ASLNPQNTVFDAKRLIGRKYEDAAVQEDMKHWPFTVVSREEKLKVQVSHKGKQRTFYPEE
ISAMVLAKMKQTAEAYLGSSVSQAIVTVPAYFSDAQRQATIDAGVIAGLQILKLLNEPTA
AAIAYGLDARNQEAGSRNILIFDLGGGTFDVSILSMEDGIFEVKATAGDTHLGGEDFDKR
LVTHLAEEFKKKHRRDLHQDKKSLQRLKTAAERAKCTLSSCTSASISVDSLFQGIDFHTT
LTRARFEDLCSDLFRATLKPLERALRDAKMSKGDIKDIILVGGSTRIPKIQKLLKDFFNG
KELNKGINPDEAVAYGAAIQAAILTGNRTPKTQNMFLLDVTPLSLGINTQGGVMATIIKR
NSPVPTKEVMEFTTTEDDQDTILFMVYEGERALTKHNHLLGMFTLKGIPPAPCGVPVILV
TFSIDENNILTVSAKDVETGNTGHLTISDTRGRLGKEEIETIVQTAEEFRANDLSLQEKI
EAMNSLESCTLELKRVAEEQLLDGKAKRRMLEMCDGAASWLEENPLAEKEECEKQQKDLE
EAWDSVYTRELAEERAEGEAEAAEPKEDME
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgcctaagcagaatgacctggctgttgggattgaccttggaaccaccttctcctgcgtg
gccgtctgccaacacgacaaagtagagatcatcgccaatgaccaagggaagcggaccaca
cccagctacgtggccttcaccaacacagaacacctgattggagaccccgccaagagccag
gcctctctcaacccccagaacacggtgttcgatgccaagcggctgattggccgcaagtat
gaggatgccgctgtacaggaggacatgaaacactggccattcactgtggtgagccgtgag
gagaagctaaaggtccaagtctcccacaaaggtaaacagcggaccttctaccctgaggag
atctctgccatggtcctggccaagatgaagcaaacagctgaggcctacctgggctcctcc
gtctcccaagccatcgtcacggtgcccgcctacttcagtgatgcccagcggcaggccacc
attgatgctggagtcattgcgggcctccagatcctaaaactcctgaatgagcccacagca
gctgccattgcctacggcctggatgccaggaatcaagaggctggcagccgaaacatcctc
atttttgacctgggtgggggcacctttgatgtttctatcctttccatggaggacggcatc
tttgaagtcaaggccaccgcaggggacacccacttgggcggggaggactttgacaagagg
ctggtgacccaccttgcagaggagttcaagaaaaagcacaggagagacctccaccaggac
aagaagtctctgcaaaggttgaagacggctgccgagcgggccaaatgcaccttgagttcc
tgcactagtgccagtatctctgtggactccctcttccaagggattgacttccacaccacc
ctcacccgggcacggttcgaggacctgtgctccgacctattccgagccaccctgaagccc
cttgaaagggccttgagagatgccaagatgagcaaaggggacatcaaggacattattttg
gttgggggctccacccgcatccccaagatccagaagttgctgaaggacttcttcaatggc
aaggagttgaacaaaggcattaaccctgatgaagctgtggcctacggggcagccatccag
gctgccatcttgacgggcaaccggacgcccaagacacagaatatgtttcttctggacgtc
acccctttgtctctggggatcaatactcaaggaggtgtcatggcaaccatcataaaacgc
aactcacctgtcccaacaaaagaggtcatggagttcaccacgactgaggatgaccaagac
accatcttgttcatggtgtacgagggagagcgggccctgaccaaacacaaccacctcttg
ggcatgttcaccttgaaaggcatccccccagctccctgtggggtcccggtcattctggtc
accttctccattgacgagaacaatattctgaccgtctcagctaaagatgtggaaacaggg
aacactggccacctgaccatctcggacacccgtggacgcttgggcaaggaggaaatagag
acaatcgtgcagacagcggaggaattccgggccaacgacctgagcctgcaggagaagatc
gaagccatgaactccttggaatcctgcaccctggagctcaagagggtggcggaagagcag
ctcctggatgggaaggccaagaggaggatgttggaaatgtgtgacggtgctgcctcttgg
ctggaggagaaccccttggcggagaaagaggagtgcgagaagcagcagaaggacctggag
gaagcctgggactcggtctacacccgtgagctggcagaagagcgggcggaaggagaggct
gaggccgccgagccgaaggaagacatggaatga

DBGET integrated database retrieval system