KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107290006Help
Entry
107290006         CDS       T05763                                 

Gene name
FKBP7
Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase FKBP7
  KO
K09573  FK506-binding protein 7 [EC:5.2.1.8]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pmur03110]
    107290006 (FKBP7)
Enzymes [BR:pmur01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     107290006 (FKBP7)
Chaperones and folding catalysts [BR:pmur03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    107290006 (FKBP7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C EF-hand_5 EF-hand_6 EF-hand_1 EF-hand_7
Motif
Other DBs
NCBI-GeneID: 107290006
NCBI-ProteinID: XP_015674329
Position
Unknown
AA seq 221 aa AA seqDB search
MALRAGPCFLLQAFALLLIPSYGQKAAGPPAEDVQIEIVHVPEVCEPKSKKGDLLNAHYD
GYVGSNKTKFYCSRTQSDGHPKWFVLGVGQVIKGLDIAMMNMCPGEKRKVIIPPSLAYGE
QGYEPAKIPPNATLMFEIELYAVTKGPRSVETFSQIDLDSDKKLSKEEINLYLKKEFERD
GKKRDSTVKDTVLVDIFKRNDHDGDGFISAKEYNVYQHDEL
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggctttgcgcgcgggaccctgctttctcctgcaggcatttgccctcctccttattccg
tcctatgggcagaaggcggcgggtccccctgcagaagatgtccagatagaaatcgtgcac
gtccccgaagtctgcgagcccaagagcaaaaagggcgatctactcaatgcccattacgac
ggttacgtaggtagtaataagaccaagttttattgcagtcgcacacaaagcgatggccat
ccaaaatggtttgtccttggtgttggccaagtcattaaaggcttagatattgcaatgatg
aatatgtgtcctggagagaaacgaaaagtgattattcctccttcgcttgcctatggagaa
cagggctatgaaccagcaaagattccacccaatgcaacactgatgttcgaaattgaactg
tatgcagtaactaaaggaccacggagtgttgaaacattttctcaaatagatctggatagt
gacaaaaagctttcaaaggaagagataaacctttatttgaagaaagaatttgaaagagat
ggcaaaaaacgggattctactgttaaagatactgttttggtagatatatttaaaaggaat
gaccatgatggcgatggcttcatatctgccaaagaatacaatgtctaccagcatgatgaa
ctataa

DBGET integrated database retrieval system