KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107290010Help
Entry
107290010         CDS       T05763                                 

Gene name
TTN
Definition
(RefSeq) LOW QUALITY PROTEIN: titin
  KO
K12567  titin [EC:2.7.11.1]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pmur01001]
    107290010 (TTN)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pmur04131]
    107290010 (TTN)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pmur04812]
    107290010 (TTN)
   04147 Exosome [BR:pmur04147]
    107290010 (TTN)
Enzymes [BR:pmur01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107290010 (TTN)
Protein kinases [BR:pmur01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   107290010 (TTN)
Membrane trafficking [BR:pmur04131]
 Others
  Actin-binding proteins
   Others
    107290010 (TTN)
Cytoskeleton proteins [BR:pmur04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     107290010 (TTN)
Exosome [BR:pmur04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107290010 (TTN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set fn3 Ig_3 ig Ig_2 V-set Pur_ac_phosph_N fn3_2 C2-set_2 Receptor_2B4 Ig_6 Pkinase Tissue_fac C1-set Ig_5 Titin_Z Pkinase_Tyr Ig_4 Ig_C17orf99 Izumo-Ig THB PPAK
Motif
Other DBs
NCBI-GeneID: 107290010
NCBI-ProteinID: XP_015674335
Position
Unknown
AA seq 35294 aa AA seqDB search
MTSKAPTFTQPLQSVVALEGSAATFEAHISGFPVPEVSWYRDGQVISAATLPGVQISFSD
GRAKLVIPAVTADNSGRYTLQATNGSGKATSTAELLVTAETAPPNFTQRLQSMTIRQGSQ
VRLDVRVTGIPTPVVKFYRDGAEIQSSPDFQILHEGDLYSLIIAEAYPEDSGTYSVNATN
SVGRATSTAELLIQGEDEAVPAKKTKTIVSTAQITQTRETRTEKKIEAHFDARTLATAEM
TIESATGQQLIHKAPPRMIPHPASKSPTPPIIAAKVQMARQQSPSPIRQSPSPVRHVRAP
TPSPVRSVSPAGVTRLSVSTSPIRPVRSPILVRKTQATAAMGADVLPPWKQEGFVATSET
RMKDTRVTMSTTQMRTEERWEGRYGVHEQVAISGAAAAEATLAIGAAAAAAAAAATEDVD
KTTAVATVVAAVDMAREREPLPSAVEQMAKRTAMAAVHIPPVQEQVKKEAAIVITTAAEK
AREQEMILRTKEAVTTKQEQIQITEEKIRKEPVKVPVPRVIIAADTIKEQELISRAREEI
PTRKEEIYITHEKIRKEAVKVPVPKVIIAPELLKQQEQISRAREEISTRREEMHIAHEKT
RKEVVKPVKPSVPKVVITADKPKVPAPVVKTTERIATKQEAQAHFIQEKVRQETEKIAIV
PKIIEVDKRKKQDIISRTREDVAVKREQIQLVHEQIDVDKKAEAVATVVYAVDQARIKEP
REPDYAEEAYSEQAALDYGYKEHALARHVVEVPPEPHVVTKEVKTEEIRIPPKIHVAAAE
IMETDISTQIKRTAETSFEKSIHVEHIRPRTASPHFTVSKITVPKPDHTYEVSIAGSAIA
TLQKELATTSVPKITKSVKRPVAKSPEPRLMPEKVASPQFPFVETPADTYQRLYGAEIKR
EIGVTVTGGLVQEREHVELMPAAEPKVIEAARVPKPTEVPATPPYIVSMLKNVTVLEGES
VTLECRISAYPAPTVAWYREDYHIESSIDFQITFEAGVARLVIREAFAEDSGKFTCTASN
EAGSISTSCYLLVQVSEEFETKEAVSAKEVIEERRYVESKDVIMAEIAAAEEVPGEAAAP
FFIMKPVVQRLIEGGSIIFECQVGGNPKPHIYWKKAGLPVTSGYRYKIIHKKETGECRLE
ISMTFADDAGEYTIVARNKHGEVSASAFLLEEADYEVYLKSQEETMYQTEVTAYVQEPKV
AAVAPPTLYADYEKEYEKEQALIRKKMAKDTVLIRTFAEEQEFHISSFEERLMKEIEYRI
IKITLEELLEEDGEEMVVDIPESETIEAGFDLRLKNYRILEGSGVTFHCKMSGYPLPKIA
WYKDGKRIRHGDHYHMEIMPDGRASLRFPVVLPEDEGIYTAFASNVKGNAICSAKLYVEP
VGPTGSPGYIPSPEMMRRYRSLSPRSPSRSPARSSPSRSPARRLDETDEGQLERLYKPVF
VLKPTSFKCAEGQTARFDLKVVGRPMPETYWFHNGQQVLNDYTHKIVIKEDGTQSMIIVP
AMPSDSGEWVVIAQNRAGKGSISMTLTVEAKEHLIRPLFIEKLKNTSVKEGDKLEMNVKA
RGNPNPDIVWLKNSDIIVPHKYPNIKIEGTKGEAALKIESTVRHDAAWYTATAINKAGRD
TTRCKVNVEVEFAEPEPERRLIIPRGTYRAKEIAAPELEPLHLRYGQEQWEEGDLYDKEK
QQKPFFKKKLTSLRLKRFGPAHFDCRLTPIGDPTMRVEWLHDGKPLEAANRLRMINEFGY
CSLDYDISYPRDSGVITCRATNKYGTDHTSATLIVKDEKSLVEESQLPEGRKGLQRIEEL
ERMAHEGAITGIVEDEKVKQKPDIVLFPEPARVLEGEIARFRCRVTGYPQPKVNWYLNGQ
LVRKSKRFRLRYDGIYYLDIVDCKTYDTGEVKISAENPEGSVEHSVKIEIQQREDFRSVL
RRAPEPRHEAPTTETGKLLFEVQKIDKPVEATTKEVVKLKKAEKVSHEKISEESEELRSK
FKRRTEEGYYEAITAVELKSRKKDESYEDLLKKTKEELLHWTKELTEEERKALEAEGKIT
IPTIKPEKVQLSPSMEAPKIFERIQSQTISEGRDAQFRVRVVGKPDPECQWFKNGVQIER
SDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAVNVAGETSSHAFLLVQAKQHITFIQEL
QDVTAKEKDSMATFECETSEPFVKVQWYKDGIEICSGDKYRTHSDRKGHFLSILMIDKFD
EDDYSCALVEDESVKTTAKLIVEGAVVEFIKELEDIEVPETFSGELECEISPEDMEGKWY
HNGIELTPNNKYVIASRRGRQILTIKDVAKEDQGEYSFVAEGKKTSCKLKMKPRPVNILQ
GLSDQKVCEGDIIQHEVKLSQENVEGVWMKDGAEIQSSDRIHIVIDKQSHMLLVEDATKE
DRGEYSFNIPSLLLVTSGHVSVSSVEIIVPLKDVHAIEGTKAILESKISVPDVSSSKWYI
NDEQIKPDDRVQAVSKGMKQRLVFTRTYASDEGQCKLAVGKVETSCNLIIEKIKIIKGLH
DITCTETQNVTFEVELSHAGIDVLWHFKDQEIKASPKYKIEAHGTIYKLTVINMMKDDEG
EYTFYAGEKKTSGTLVVAGGAISKPLTDLTVAESQKAVFECEVANPESVGQWLKDGKPLT
MTDRCKSESDGLKRRLIIPISKLDDVAEYTFRVASSKTSAKLKVETVKIKKTLKNLTVTE
TQDAVFLIELTHPDVKGVQWIKNGVELHPSDKYEIKVEGTIYTLKVKNCAVADESVYGFK
LGRIGANARLHVETVKIIKKPKDVTALENAVVSFEVSVSHDAVPVKWFHKNVELKPSDKC
RLSSQRKVHKLTLQNISPADAGEYTAIVGQLECKAKLFVETVHITKTMKNIEVPETKTAS
FECEVSHFNVPSVWLKNGVEIEMSEKFKIVVQGKLHQLNIVNTSSEDSAEYTFICGNDKV
SATLTVKPVLITSMLKDINAEEKDTITFEVTVNYEGITYKWLKNGVEIKSTDRCQIRTKK
LTHSLSIRNVHFGDTAEYTFVAGQAASAATLYVEARHIEFRKHIKDIKVVEKKRAVFECE
ISEPDISVQWMKDGQELQLGDRVKVQRERFVHRLLITSTKMSDSGKYTVVAGGNMSNANL
MVEGRDVRIRSPQKNVQVLERQRAVVEFEVNEDDIDAHWYKDGIEINFQIEERYHYEVER
RVHKMIITETRYTDAGEYTFLAGKNRSSITLYVNAPEPPKIVKELQPATVESGKPARFCA
IVSGRPQPKIFWYKDEQPLSPGFKVKFLHDAQEYTLLLIESFPEDAAVYTIEAKNDYGIA
TSSASLSVEVPEVVSPDVEVPVYPPTIITPLRDAVTSEGQSTFFQCRVTGTDLKISWYSK
DKEIKPSRFFRMTQFEDTYQLEIAEAYPEDEGIYTFVASNSVGQVSSTATLRLEDLEKVI
QEKIEQQIELEVKEMSSSVTVSTKEESIKSFNSDLQLYDKNTTHELRPEKSIYSNNLDKK
EEKRNIPSFLKHVSNVEVSVGDLAKLSVTVTGNPKPQIQWFFNNVKITSSADYKFVFDEE
SYSLIILSANFEHEGEYTCIASNSHGETACSAYLKVNPKGGSTESEIIRAVSTEMIGGPQ
SPHFVRKLNPAHFVQGAPAVFEYNVIGEPAPIIHWFRGNDQIFSGVHYTIIHNPDGFGSL
TVNNCQREDGGLYFCKASNILGEATSSAKLIITQDIEDIVDVAHKTSNIVAATSLTVSEV
KEYCGFLEQHSEAIQSSPLLQVFSSKCPQISDICLPVMEEANREEKEKQLPMKLPEIINP
ESVREETSPLISILSEEKYGISLDESLIFSAPKAEEAISAQETKQEVYISGADSIQKLSK
ESSLAVHVHKSEKGVLVQEEHSCFQSVIATQQYEIHEALIGTINNLDTLEKVQPTQESIE
ALQVPLIASEEIFPKEKTFEATVEELQKGSLKHDNLVKANLMAEEKQKLSHELTERIPQL
EGTVLAEVQKESGNPLHLPIVFEQATLPKEEHFSTEVPPEDEVVSSKSQSLLHSLIVEEQ
LPTTSEEAKLLSSLGEAVSLQLVKEPVSVSHLQINNSEQVLSKEDILTLPKPECQAAVQK
AESMIKCTANWEEQRPISADTLEATRYGIAGEKSLATSEPQLRKCLTVVAEEWPLPKEQI
LPQMDTERKAALKKDDSQMVMQASVITETRALAAGHIKPFKDVEGKNCGITSELKLVLES
VCVEECGVPIENADLLEATGQDFAARIQEGQSIRLPLILEEKQPFKEEHLKELTSPESQH
TTVHKESRMVMGVPQTLENQTLSKESQLAQETPVCCSLDMKPPVRSALKTALINEHHSFS
FDTFNDIEKIKLKTIKIVQEPKHTLFICLVTKESSNTAEISLPFDRIYSHKVTIRNELQP
PFQPIIYEEKHILMADEPKVIKETKSYNLLVISSPFREIHSSIVTDMPIQEQTVGDLTGY
PEPQYARISPESKLQLEQLVSAQEVKILALKEQIKDDSSSMPASAEKLIFFLKVGERKEE
HNKETHLFEAKEQKNRSPILNLGLKDTVVEEGDGVQFTSKIANAEVVNWYFESNLIFSDS
EFECLQEHDTYTLIINQALKEVHQGEYTCEALNENGKTTATATLTIVKRVAPMLRRRLES
QEVAVNHLAKFTCEIEMAPDVRFQWYRAGREIYDGDKYTIYTANYISTLQIPRPQVVDCG
EYTCKASNQYGSVSSRATLTVTEAFPPTFVTRPESLTTFVGKSARFPCSVAGTPVIDTVW
QKDGTPISSTEHYKILASDTKHSLEIAHLTINDRGVYSCKASNKFGADVCQAELTIIDKP
HFIKELQSVQSAVNKKIRLECQVDEDRKVTVSWTKDGHKIPPGKDYRIMFEDKIASLDIP
LSKIKDSGTYTCTATNEAGSSSSSAMVTIKEPPSFVKKVDPSYLLTPGESAHLQCKIKGS
PVIQVTWFKNNKEIRESDTSRMSFANNVAVLDISNMKVDDSGSYSCEAVNDAGSDSCNTE
IVVKEPPAFIKTLEPAELVRGTNAILQCEVSGTGPFEISWFKEKKQIRSSKKYRLASQKS
LISLEITSFNSADVGEYECSIANEVGKCICSATYILKEPPSFIKKVEDVTTLAGETIFLQ
AVVKGSAPLSVTWMKGKDIIKEDNKVKITFENGLATLEISGVQVNSSGKYTCLVENDAGS
QTCFGQLAVKEPATIVDRAEFVQVTAGDPAILEYTVAGTPELKTKWFKDGKALVSNKKYR
ISFKNNVAQLKFYTSELHDTGEITFEVSNDVGRSACTTTFSVIDRTLPPFFTKTLRNVDS
VVGGTCHLDCKVSGSLPIKVSWFKHDKEITPSAKYAIRYEEGSASLEIKKLDTKDVGVYS
CKATNSAGSKECSSALAVKEPPSFITEPESQEILPGSTVRLKTTFKGTAPFSVQWFKGDA
KLTTGGACYIMTEAFSSYLELYAVKPANSGVYACKVSNTAGSIECSAHLFVKEPASFSER
LEPSLLFKKGEYAQLDCKVKGTPELKISWFKDDREIKESDKYKMTLMDATAVLSLLDVTI
EDSGVYMCEVKNDAGKETCSSMVAVKESPYFIKEFEPREVLRDSDVILECEVLGTPPLEV
YWLKDNKPVRSSRKHRITTEKSLFSLQVFKFDSSDAGEYQCRVTNDVGSCVCSSELALKE
PPQFVKRIENISSLQGGTVVFQATVKGSMPITISWLKDNDDIIEDDNTKMTFLNNVATLM
IRAIEVKHDGKYFCQAKNEAGIQRCSALLTVKEPATIIDKAVSIDVTEGDPATLQCKFSG
TKDISAKWFRGGKELTFGPKHKISVTDTVSMLKIVSTEKNDSGEYTFEVSNDVGSSSCKA
SINVLDLIIPPKFTKKLKKMDSIKGSFVHLECIVSGSHPISIQWYKDGQEISASEKHKYS
FHDNTAFLEINQLEGSDSGSYTCEATNEAGQNQCSAYLTVKEPPSFIEKPQSQDVIPAAR
VQLKTLVSGTPPLQIKWIKDSKELLSGASRSVYKDDTSSVLELFSAKLSDSGNYICQISN
DVGSTTCKATLFVKEPPRFIQKPSPVVVLRKGQSTIFECQVAGTPKIHVAWYFDGNEVFD
SDKYEISFVDNIATIKIINAMVEDSGTYICEARNDAGSKSCSTELKVKEPPTFIRELKPV
EVVKRYDAVLECEVTGTPPFDVIWLKNNTEIRSSKKYTMVDKQFIFALQTMNCDSQDAGE
YQCVISNEGGSCSCSTKVSLKEPPSFIKKIENIHAVLKESATFQCVVAGSQPLTVSWIKD
ERILENDENFHITFEQNIAKLKVKKVDLSHSGRYTCQAKNEAGVEKCFALLLAQEPAQII
EKAKTVKVTERDPVTLECTVSGTPELQVKWFKDGKQLMPSRFYTMSLDNNVASFRMESVV
KEDSGVYTFKVENDYGSQTCEAVVTVLDQAIPPSFTKKLSKMSKILGSSIHMECKVSGSL
PITAKWYTDGKEISDSAKYRSLCHENTVLLEINNLELTDSANYTCSVTNIAGSDSCSAIL
AVKEPPSFLAKPESQEAVPDSTVEFKAVLKGTPPFKIKWFKEDLELAPGPNCAFGIEGSA
GFLNLYSVDGLRSGNYTCQVSNDVGSDSCTTTLIITEPPKFAKRLDPLSVVKHGDFTRFE
CKVTGSPEIRVVWYRNDTELHASENVHMSFVDSIAVLEMRHLGIEDSGDYICEAQNPAGR
ASCSTKLLVKEPPVFSRKPSPVDTLKGTEVRLECEISGTPPFDITWYKDKRQIRSSKKYK
VTSKNYLANVHILNVETSDIGEYQCKAKNDVGSDTCICTVKLKEPPKFVTKINSLTVVVG
EPVELQATVEGSQPISVIWLKDKEDVIRESENTAITYLDNIATLQLAKAELSSAGKYICQ
VSNDAGTRECMATLTILEPAVIVEKAEPMNVTVGDVCTLQCKVSGTPELSVGWFKDGKEL
ISSDKYRIVFYKNTSTLKILDSESEDSGLYTFEVQNNVGKSSCTASVDVLDRIIPPSFTR
KLKESHGVLASSVLLECKVAGSLPITVAWFHNGQKLTSGEKHQITFSDNVCSLQIASLNL
SDTGAYICKAANVAGSNETRAVLTVQEPPSFAKEPESVHILPGRSATFSATIKGTPPFKV
NWFRGVNELVPSDKCNICLEDSVTDLELYDVEPSQSGEYTCIVSNEAGKASCTTHLLVKE
PAVFVKKLSDHCVEPGKSIILESRYTGSLPISVTWMKNGVILSQSDKCSITTTEKSCILE
ILNTTKDDQGEYTCMVENEAGEDICEALVSTLEPPSFITHLGPLEVSVGDYTTLHCQVSG
TPEITISWYKGDTILRSTPEHKMYFKDNVATLIFNKVDISDSGEYICKAENSVGSASSNA
ILTVQERKRPPSFVRQLKDTEQTIGFPVKFVCRLNGSEPISVTWYKDGVPLRDDFNVQTS
YIDNVATLHLLQTDMAHSGQYSCTATNPVGTVTSNARFTISETKQAPLFDITPESRDVPV
GKGVDFECHVTGTHPIHAIWAKDGREIRTGGNYAITFVENTARLRIMRAGKGDSGQYTCQ
ASNVVGKDFCSAQLNVKEPPKCVKKLEASRMVKQGDSCQLDCKVSGSPEIKIAWYKNDQE
LHASEKYHMTFSDATAVLVIVDANLEDSGDYICEALNSAGTVSCSTVVTVKEPPVFSKKP
SPVDTLKGTDAILQCELTGTPPFEVAWFKDRKQIRGSKKFKITTKNFSASVHVLNLEAAD
IGEYQCKASNEVGSDICTCTVKFKEPPRFVKKLSDTFTYTGEPTALRAVVEGSQPISILW
LKDKGEMIRESENLQISFSDNIATLQIASAETASGGKYICQIKNDAGMRECAGYLKVLEP
AVILEKSEPMIATAGSAFTLECTVGGTPELITKWFKDGRQLANSRKHQIIFSNKVATLKV
LSADMDDRGLYTFEVQNEVGKSSCTSSVDVSEHLIRPSFIRRLKETFGVLGSSIVLECKV
AGSLPMTVAWFYGSDEIFSGDKYETSFSDNVCILKVNALDISDTGPYTCTAANVAGSDEC
SAFLTVQEPPSFAKTPDPLEVLPGKSVTFRSLIRGTPPFKMNWFKGSRELVPGKTCNILL
TDSTAELELFEVGPLQTGDYTCLVTNDAGSCSCTTHLFVKEPAVFVKKLSDFSVEHGNSI
ILESRFGGTPPLLVTWKKNGSKLTQSPKCNITTTEKSGILEILSSSREDEGEYTCEVAND
AGEDVCHALVSILEPPYFIKDLERVEVTIGEPLSLRCQVAGTPEIKVSWYKGDTKLRSTQ
AYKMHFKNNIATLTFSQVDNADIGEYVCKIENSAGFATSTAVLAVKDRKLPPSFTKKLKD
VQEMIGSPVAFDCRIIGSEPLQVSWYKEGVLLRDDHNIQATFLNNVATLQILQTEMAHSG
QYTCTAQNALGTASSSAKLQLSEHLIPPSFDVKPLPVEVALGGSGSFKCHITGSMPMKIT
WAKDNRDIRPGDNYKITLVENTATLTVLKVGKGDAGLYTCSASNSAGKDTCGAQLSFKEP
PRFIRKLDSSRVVKEHDSTRYECKIAGSPEIHIAWYKGETQIHPSDKYSMSFIDSVAVIE
MHNLTVEDSGDYACEAQNPAGSASSTASLKVKAPPVFRKTPQPTESLKGVDVHLECMLQG
TPPFQISWYKDKREIRTSKKYKMLSENYVASLHILNTDDADAGEYHCKAVNDVGSEACIC
SVMLKVPPRFVKKLHDVSAIVGEPAELQATIEGSEPISVLWLKDKGEIIHESDNLWMSYT
DKVAILQVVHAEPTYMGKYTCQIKNDAGSQECFATLSVLEPATITEKPEPMTVTTGDSCT
LECTVSGTPELTTRWFKNGYELTSDQKYKITFFNKVSVLKILNAGLQDSGEYTFEVKNSV
GQSRCTASIHVSDRIIPPSFTKRLKETQGLLGSSSVLECKVIGSPPISVFWFRDGEEITS
GEKYQATLTDNTCSLKVNALQESDIGSYTCIATNEAGTDECEAYFIVREPPSFVKKPEPL
QVLSGANVTFTSIIKGTLPLDVKWFRGSVELVPGHRCNVSLEESVAELELFDVHPVQSGD
YTCIVSNEAGKISCTTHFFVKESAKFVKKLNDFHVEKGKQLILECSYTGTPPIQVSWRKN
GINLTQSEKCSITTTETSAILEVSNSRLEDAGLYSCHIENESGQDNSQAAVSILEPPYFV
QNLESVQVTVGDSASLQCQIAGTPEINVSWYKGDTKLRPTSTSKMHYKNQVATLVFSQVV
SNDSGEYICKVENSVGEAVSSALLSVQERKLPPSFSRKLRDIHETVGLPTTFDCGINGSE
PIEVTWYKDGAQIRDGYNVQISYLNKVAVLQISQTDMSLAGQYTCTASNAIGTASCSAKL
ILTEGKMPPFFDIPITPVDAVVGDSADFECRVSGTRPIKIAWSKDNRELRTGGNYQISYT
ENIAHLTILKVDKGDSGKYSCHASNEVGKESCTAQLNIKERQNPPTFTKKLSETVEEAEG
NSFKLEGRVSGTQPLMVAWYKNNQEIYGSPKCELAFENNTILLLIKNAEPADAGLYTCKV
SNEAGSALCTSSVVIKEPKKPPAFDRPLKPVTIDEGKILQLACHVVGSQPIKIQWLKAGR
ELRLSDKCNFSFANGTALLEIQAVTKTDSAEYVCKASNAAGSDSSKSKVTIKEKPAAAPV
AKKAPTDARLYFVSEPQSITIIEKSLATFTAKVGGDPIPNVKWMKGKWRQLNQGGRIIIQ
QKGDEAKLEIKDATKTDSGQYRCVAFNEHGEIESVVNLQVEERKKQVIEGDLRAKLKKTP
TKKKEGEEEQAIDIMELLKNVDPKEYEKYARMYGITDFRGLLQAFEMLKESQAEETHRLE
IEVKERSRREEQEFDELVAFIQQRLTQTEPVTLIRDIEDQTVLTEEDAVFECEIKINYPE
IRLTWYKGTERLISNKKYEIKIDGDRHILKIRDCQLGDQANYRVVCGPHIASAKLHVIEP
AVERHLRDTSLKEGFTCSLVCQFSVPNAKSQWYRNGKVLQIGGRYSTDVSDKVHRLIIKD
VRTEDQGQYTCRFDHLETTADLIIEAEPIQFTKTIQNIVVSEHQSATFECEVSFDNAIVT
WYKGPVELKESPKYSFRSEGRCHYMTIHNVTSDDEGVYSVIACLEPRGEARSTAELYLTT
KEIKLEIKRPDVPDARVAVPIEVPAEDVPVLPILIPMPEEKKKKEKVVRKKILKKVTPKV
PEEVPPPKEPVKKPEPEPPSAPVPVPVPVSVPAPKAEEVILTKVPAKKREEVKVTTVITK
KEPAFEKREEIHEVRKETYEEWEEGYGEKHEYYEKEEGYDEGEEEWTYEERKEKKPAYQE
EWEEEYGEQHEYYERKEGYDEGEDEWAYTEKQVTLKKKPVYHEEVVQVPKKPEPVPKRPE
ISAKKEEKKKITIQKVTRKPVTEEVAKTAQQLEEEQLRRVKAPEVPSKKPTKMVIHEEVI
ERKVPAEQKWTVSEEKVTVSYHEEEYTYGSEPEEYEREEFYVEYPTEEPEEYEEERVYVE
VPEVLPTKGVPKKPEEKVPVTVLKKIEPPPAKVPEVPKKPVPEKKKPPPPPEKVEAPPAK
VPEVPKKPVPEKRKPAAVPKKEVPPPAKVPEVPKPVPEEKVPVPIPKKVEPPAKVPEVPK
KVIPEEKVAVPKKKEVPPAKVPEEPKKAIPEEKVPRLRKKEVPSAKVPEVPKEVIVEEKI
TVAVPKRVEPPPAKVPGMPKRAVVEEKRFVSEETVSVTISKRMEAPLPKVEKWEEEVEEE
EVEVVVEEEEEEELPISRWREEEVSYEEEEEISEVTEEAYYAEEEVHITVPEEVPPAKVP
EVRKRPEPAKKEPVVPPKKVEAPPARVPKKVPPEEKVPPKVKEPPPAKVTEIRKKKVVTE
EKISVSKKEEAPPKKVVPKKVVPEEEVRVPIPKKVVAPPPPKEVPELPKRLVSEEKVSMV
IPKRKVAPPEKAIEERWGYAEEVSISVHTGEEVSYTVPEEPERAIRKEKMPISITTKMKK
PPAKVPEVRKTVIKKEVVHVTVPPYEEEAPEYEEEEVPQYEEEEVPQYEEEERYEEEVSR
YEEEVSRSEEEVSRYEEEVSRYEEEVTHEEEEVVVVPHYEEVPEYEEEEEIPPPPPHKVP
EVAKKPVPEKKKPVPVPKKKEAPPAKVPEVPKKPVPEEKVPVPKRKEAPPAKVPKKPVPK
EEVPVPVPKRVEAPPVKVPEIPEEAEIEAEVPLPAKVPEVPKKVVPAKKIPEPVPKKVEP
PAPPVAKVPKAVPEEEVPVPKKVPAPPAKVPEVPKPVPEEKVPVPKKVPPPPAKVPKAVP
EEEVPVPKKVPAPPAKVPKPVPEEKVPVPKKVPPPPAKGMPNCYLSSVLLDMNFGTSKSV
MSYICAPVETNIFIKIFHIILKVPEVPKPVPEEEVPIPKRVPAPPAKVPEVPKPVPEEKV
PVPKKVPPPPAKVPEVPTPVPEEEVPIPKKVPAPPAKVPKVPKPVPEEEVPVPKKVPAPP
AKVPEVPKPVPEEKLPVPKKVPAPPAKGTGEICNTVKTKFTIHFIMILLLRVKCPDLPEV
PIPVVEEEEEEEEEEEEVPVPKKVPAPPAKVPKRVPEEKVPVAKKVPAPPAKVQVPEVPK
VVEEEEIFEVPKKVPAPPAKVPEVPKPVPEEKVPVPKKVPAPPAKVPEVPKPVPEEKVPV
PKKVPPPPAKGTSNIYNSKRKTLRLKFLIIHIVQLPEVPKPVPEEKVPVPKKVPPPPAKV
PKPVPEEKVPVPKKVPAPPAKVPGVPKPVPEEKVPEAPPKVPVPPAKVPVIRKKIVHKEK
VTAPVPTAEEYVYEEYEKYETYEEAGVYLPAEEAEELEEYAEVQEEPEVEYYEEVSEERE
VEHYEEAPEEPEAEEYKETVEAEEYEYYEEVQVIKETEEYEEVYEVPPAIEPEVRKPVPK
EKVPTAVPKKEVAPPPKVPEMPKKVMLEEKVIVAVPKKPEPPSPAKVPEVPKKAVPEEKV
PAAVPEAPPAKVPEVRKKPIPEEILVPKKPEAPPAKVPEVPKKPVPKEKVPVAEPKEPEA
PPAKVPEVPKKVVPEKKVPTKVPKKPEVPPAKVPEIPKEVVPEEEFQVPEIKKPEPPPAK
VPEVPKKVVPEKEPIEPEAPPAKVPEVPKKVVPEKKVPAKVPKKPEAPPAKVPEEVVPEE
EVPVPEIKKPEPPPAKVPEVPKKIIPEEKVPVKKPEPPAPKVPEVPKKVVPEKKPAVPEA
PPSKVPEVPKKIIPEEKVPKKPEPPAKVPEVPEKVIVEEKEPTPVLKKPVIKKPEAPPVT
GTSPNSSKIGQIKFANKKVILVLSKEPEHFAVTEEPEPVAVTKEVETLVHVEEIEVTVVL
EEPKPAIVPKKPKPTTVPKKAEPTAVPKKPKAVPKKPEPPPTKEVYEEEREIHTVIGYRE
EKIVTVHQDVEAIGALEEPEHAAVFEVTESEEYILEEREAIVSPAEPEPVAEPEEPAIVP
VALPKKPEPAVPKKPVVAVPKKPKVTPIPKKPEPVEVPKKPIFKIKKREHPPEIVEHKEE
KEIPTFIARREEKRVAVYKEEAEAITAFEEPERASAFELTEPELYVLEEPEDIVSYEEPE
LVPEEPEVTAIPEEPEVAPVLEEPEVAPVLEEPEVAPVPEEPPAVPKKPTEVPKKPKVVP
LPEEPAPAITPKKPKPVAVPKKPEPAVPKKPEPAFKKPTLTPVPKKAEPPKKKEPEFKKP
ELPPETVEHEEEREVQTFIGYRERKRIPVHQEVEAITAFEEPEMVSAYEVTEPEVYVLEV
PEEEEPEPVVVPEELEVAPVPEEPPAVPKKPTEVPKKPKVVPPPEEPAPAITPKKPVGVS
KKPEPAVPKKPEPAVPKKPEPAFKKTKLTPVPKKVEPSKKPEPEFKKPKLPPETLEPEEE
REVKTFIGYKERTRVSVHQDIEAITAFEEPEAVSAYEPTEPEVYILEVPEEAVPTPEEAE
PVVPEEPEITKEPKIPEPVKVPQVPKKAVPEEKVPVAVPKEPEHPPEEEPEVIEEIEAEE
PVPISEKEDIIPTEEPEPEKKIFPKPKPRVPIPPKEEVEEKVQLKVPGLKPRKQLPERPA
PAPKEEIVLKRVTKAVQKPEEEEPKPAKPPKVEPKPVEKIKKPEVPEIEKKKIEIPTIKK
KEEIEKPVPEPAKVPEPKPAMIPEPKPAVALKSPRPAVAPALDVAPVMAPVVGKIAEPKI
TPKEEAAKGRSPIKAKRTPSPLDAERRKLRPGSGGDKPPEEPPFTYQLKAVPLKFVTEIK
DIVLTEAESIGSSAIFECLISPSTAITSWMKDGSNIRESPKHRFLSDGKDRKLHIIDVQL
SDAGEYTCVLKLGNKEKTSIAKLVVEELPVRFVKPLEEEITVIKGQPFYLSCELNKERDV
VWRKDGKIVSDKSGKFALGIIGLQRAVTIMDADDNDSGEYTVTVADSDLSCKTTVKVVEM
IKDWLVKPIRDQHVKPKGTATFSCDVVKDTPNIRWYKGEEEIPLEPNDKTEIVKDGSHIF
LKIKNCSPDDVGEYSVEVEGRRYPAKLTLGDRDVELLKPLEDVTIYEKETANFDTEISEE
DIPGEWKLKGEILRPSPTCEIKAEGGKRFLTLHKVKVDQAGEVLYQALNALTTAILTVKE
IELDFAVPLKDVTVPEKRQARFECVLTREANVIWSKGTDIIKIGDKFDIIVDGKKHILVI
NDSQFDDEGEYTAEVEGKKTTARLFVEGIRLKFITPLKDQTVKEGETAYFDFELSHEKMP
VTWYKNDKKLHNSRTVHISAEGKNHKLEISEVTLDDISEIKAVVKNLHTQAHLKVLEADP
YFTVKLQDYTAIEKDDVILECELSKDVPVKWYKDGEELVASKRISIKTDGKRRILKIKKV
SDADKGNYECNCGTDKTNCELKVEPRMINIERPLYGVEVFIGETARFEIEISEPDVPAIW
KLKGETLTASPDCEMIQDGKKHILILHNCKLDMTGEVSFQAANAKSAANLKVKERPLLFI
TPLSDVKVFEKDEAKFECEVSREPKTFRWLKGTQEIPEDVKFEIKSEGTRHALVIKSVAF
EDEAKYMFEAEDKRTSAKLIIEGIRLKFITPLKDVTAKERESAEFTVELSHDNIPVIWYK
NDQRLHTSKVVSMKDDGKFHTLTFKDLTIDDTSQIRVEAMDKSSEAKLTVLEGDPYFTGK
LQDYTAVEKDEVILQCEISKANAPVKWFKDGQEITPSKNVIIKADGKKRMLILKKALKKD
IGQYTCDCGTDQTSAKLNIEDRDISIVRPLYSVEIFETETARFETEISEEDIHANWKLKG
ESLTQSADCEIKEEGKRHCVVLYNVRLNQAGGVDFQAANVKSSAHLRVKPRIIGLVRPLK
DVTVTAGETATFECELSYEGIVVEWLLKGEKLEPSDKVVPRADGKVHTLVLRDVKLTDAG
EVTLTAQDFKTKANLFVKEPPIEFTKPLEDQTVEEEATAELECEISRENAPVKWFKNGQE
IHKTKKYDIIADGRVRKLIIRDCTLDDAKTYTCDAKDFKTSCFLNVEPLRVEFLKPLTDL
EVKEKEAARFECEISRPSVKAQWFRDGVEIKKGKKYDIIAKGAQRILVINKCLLDDEAEY
ACEAKAARTSGMLTVIEEEAVFTKNLPNVEVNETDTIKFICEVSKPGAEVTWFKGDQELP
EGGRVEQKVDGRKRILIIHNACLDDAGAYSCKLPNAQTTGKLKVNELSAEFITKPQNIEV
IEGQKAEFSCSVSKDGVDVQWLRGDTILEAGDKYDIFSDGKKRVLAIKESVLDDEGRYTV
MLGDVKAKALLKVIEKLRIVIPLKDQTVKEGEELVFNCEVNTEGAKAKWYKNNEPIYDSA
KYIMVHKDLLYSLRIRDAHLNDQAVYTVTLTNPRGEHVKSSANLTVLEEDLRIVEPLQDI
ETMEKKSVTFWCKVNRLNVKLPWTKNGEEVTFDRRILYKVDRYKHSLIIKDCGFIDEGEY
TVTAGQDKSVAELIITEAPADFIEHLQDQTVTEFDDAVFSCQLSKDKAAVKWYRNGREIK
EGKKYQFEKDGNLHRLIIKDCRLEDECEYSCGVDDRKSRARLFVEEIPVEIIRPPEDIYE
APGADVIFLAELNKDKVEVKWLRNNMIIVQGDKHQMMSEGKIHRLQVCEIRPRDQGEYRF
IAKDKEARAKLELAAAPRIKTGDQDLVVDVGQPLTMVVPYDAYPRAEAEWLKEDEALPTQ
TVDTTAESTSFRIPAAKPSHKGSYKVILKNKHGKAEGRINVQVINVPGPVRNLEVTETFD
GEVSLAWEEPESDGGSKITGYVVERRDIKRKTWILATDRADSCEYTVTGLQKGGVEYLFR
VSAKNRVGTGEPVVTDKPVEAKSRFEVPGPPLNVQVADVNRSSATLTWEPPEYDGGSPIT
GYVIELRDRGSIKWEPAMTTPAHELSATLTDVVENKEYFFRIRAQNQVGVGKPSASTHAV
KITDPIERPSPPINLDHSEQTKSSVKLAWERPLKDGGSPILGYIIERREEGTVDWIRCNA
KLAPKLSYTVTGLTPLAKYYYRVSAENAAGISDPAEAIGPLTADDVHVGPTMDLSGFKDG
LEVIVPQPVKIRVPITGYPVPKATWSVGGKVLEDSDRVKIETNIAFAKLTITPSERRDKG
IYSLKLVNPVSSVSGEIDVNVIACPSAPRELAVGEITRNTVQLTWEPPENDGGSPLTGYL
IEKREVSRKIWIKVIDKILDQEFIVPDLAQGKEYLFKVSACNKCGPGEPAYIDEPINMTS
PATVPDPPENVKWRDPTSKSIFLTWDPPKYDGGSRIQGYLVEKCQRGTDKWEPCGEPVTE
TKMKVAPLKEGEWYAYRVKALNRQGASKPSQPTDEIQAVDAMEAPEIFLDVKLLAGITVK
AGTKIELPARVTGKPEPRITWTKAETILRPDKRISIETKPGHSTVIILDSKRSDSGTYII
EAVNTSGRATATVEVNVLDKPGPPAAFDVSEITNVSCLLTWNPPRDDGGSKITNYVLEQR
ATDSEIWHKLSSTIKETKFKVTKLTPLKEYIFRVSAENMYGIGEPALSHPIIAKYPFDTP
GPPTGVKPVEITKDSVTLTWTEPDEDGGSPITGYWVERFDPDQDKWIRCNKIPVKDATFK
VKGLTNHKKYKFRVLAENLAGPGKPSKPTEPILVKDPIDPPWPPGKPTVKDVAKTTCFLQ
WTKPEHDGGAKIESYVVELLKTGTDEWVRVAEGVPMTEHFLKGLMEKQEYSFRVRAVNKA
GESEPSEPSDPVLCKERLNPPSPPRWLEVINITKNTADLKWTAPEKDGGSPITNYIVEKR
DVRRKGWQTVDTTVKDTKYTVTPLTEGSLYVFRVAAENAVGQSDYCEIEDSVLAKDTFTT
PGAPYALTPVEVTKRHVDLKWEPPKNDGGRPIQRYVIEKKEKLGTRWVKAGKTAGPDCQF
RVTDVIEGTEVQFQVRAENEAGCGHPSEPTDILAIEDPTSPPSPPLDLHVTDASRKHIAI
AWKPPDKNGGSPIIGYNIELCEAGTEKWMRINSRPVKDLKYKAEEGIVPDKEYVLRVRAV
NAIGASEPSDISENVVAKDPDCNPTVDIKTTDIIVVEGQKLSVPVPFRAVPSPTISWHKS
GKELKAGDRTTMKSDYTSALLEITNAVHADAGVYTITLENKLGSTTGTVNVKVIGLPGPC
KDIKASEVTKSSCKITWEPPEFDGNTPILHYVLERREAGRRTYIPVMSGENKLAWNVKDL
IPNAEYYFRVKAVNKIGGGEYLELRNPVIAEDPKQRPDPPLDLETHNPTSKSVTLTWKPP
LYDGGTKIMGYVLEKLVKGGDKWERCNDYLVPLLTYTVKDLEEGKEYQFRARAENAAGVS
EPSNITPLIKAVDPIEAPKVSLSANLQAGLEVKQGADIPLDARISGSPYPEIAWLWNDEV
IRSEEIKKRVVKVSRKKKGEAEDDEPFRLSLPERLSIDNSKKGESSLVVRDSLRADHGTF
TIRVENDHGVAKASCEVNVLDVPGPPVNFIFEEVRKNSITCKWDPPLDDGGSEILNYVLE
KKDSAKTETGWVTVTSTLRHCKYNVLKLIEGKEYVFRVKAENRVGPGPPALSKPVVAKDP
FGPPDAPDKPLVEEPTSSSMLVKWNEPKDNGSPILGYWIEKREINGTHWARVNKDRVNAL
ETRVEGLLEGLTYVFRVCAENAAGPGKFSPPSDPKIAQDPILPPGPPIPRILDTSSTCID
LAWEAPLYNGGGDITGYHVYKQFLGSNEWSRCTEKPVKVLSYLVKGIREGADYKLRVTAL
NIAGEGPPGETEPITVAEPKEPPTVELDVSVKQGVQILAGQTLTLPATVTGRPHPTIVWT
LEEGEIDKDRVVIENVGTSSVLSIKNALRKDHGRYVITATNESGSKFAATRAEIFDVPGP
VTDLHPVVVNRKMCLLNWDDPKDDGGSEIIGFIVERKDAKMHTWRLAVDTERSKCDITGL
VEGQEYKFRVSAKNKFGCGPPVELGPLLAVDPKGPPTAPERFMYTERTKSSVTLDWKPPR
NDGGSPIIGYLVDKRRHDSNEFERVNKTPCRATSLLVDNLAELHMYEFRVKAVNEIGESE
PSLPLNVVIQDDEEPPTVTLRLAVRGDTIKVMAGQPVNIPADVTGLPMPKIEWSKNEVPI
EKTSDALKITKKEISRTEAKTELSMPAVTRNDKGTYTVTAFNRLGTAFRNVHVEVFDRPS
PPRNLAVSDIKAESCCLTWDAPLDNGGSEITHYIIEKRDASKKKVDWEEVSSTVVDRRFG
VYKLTTDGHYQFRVRAVNRYGTSDECLSEKVVIKDPYGLPGPPGKPKVIDHTRSSMLVTW
TPPLDNGGAPITGYWLEKKEEGGVYWSRVSRAPVTKPSVKGLDFNVLRLIEGVKYQFRAM
AINIAGIGPPSEPSDLVEAADPIFPPGAPSCPDVKDRTKSTISLAWKPPQKDGGSPIKGY
IVEMQEEGSLDWKNVNEPDKLFPTCECTVPNLKELRKYRFRVKAVNAAGESEPSLATSEI
PCKEILEEPEIFIDLKAQDLLSCRTGSAIKIPAIIKGRPVPKVTWEFEGDAKKAVKDGHN
IPEDATVESTDTSSVITIPECNRGHSGKYSITAKNKAGQKTVNVRVNVLDVPGPPKDLKV
SDITRCNCKLSWKMPDNDGGDRIRNYIIEKRTVEGKAWTKVNPNCAGTSLIIPDLIAGQQ
YFFRVRAENRFGVGPPADTIQRTTARDPIQPPDPPIKLKIGVITKNSVNLTWKPPKNDGG
APVTHYNIECLRWDRTGQGKEAWRQCNKRDVEETKFTVEDLNEGDEYEFRVKAVNEAGPS
RPSATVGPIVVKDQTCPPSIELNEFMEAEEGTDINVVAKVKGVPFPTLTWAKAPPKKPDD
KLPVVYDQHVNKVVGEDSCTLVIQQSRRKDTGLYTLTAVNNFGTDSKEMRLNVLGRPGPP
EGPIKFESISADQMTLSWLPPKDDGGSKITNYVIEKREANRKTWIKVTNEPKECIFTVPK
LVEGHEYIFRIMAQNKYGIGEPLDSEPETARNLFTVPGICDKPTISSVTHDSMTVNWEEP
EYDGGSPVTGYWLERKETTGKRWTRVNRDPIKPMTLGVSHKVTGLIEGSDYQFRVYAINA
AGVGPPSMPSDPITARDPIAPPGPPIPKVTDWTKSSVDLEWAPPLKDGGSKVTGYLVEFK
EEGKEEWEKAKDREIRGTKFVLAGLKEGGFYRFRVRAINAAGIGEPGEVTEVIEIKDRIV
PPDLQLDAHVKDRIVVHAGGVIRIIAYVSGKPPPTITWSQDERPLPEEAKIEETAISSSM
VIKNCKRSQQGIYTLLAKNAGGERKKTIIVDVLDVPGPVGVPFLTENLTNDSCKLTWFSP
EDDGGSAITNYVIEKREADHRAWTPVSYTVTRQNATVQGLIEGKAYFFRIAPENIIGMGP
FVETTKELLIRDPITVPERPEDLEVKAVTKDSVTLTWNPPKYNGGSDITMYVLESRLIGK
DKFTRITKEKMLDRKYTVEGLKVPLCMLIAHSRTLXHPVPFGSKTSPPQLELDIREKLTV
RVGEAFSLTGRYSGKPTPKITWYKDDITVKEDKRTMIQTTPATICLGILKSVREDSGKYS
VVVENSSGSRKGFCQVTVVDRPTPPVGPVIFDEVHKDHFVISWKPPLDDGGSPITNYIIE
KKDANRDLWMPVTSASVKTTCKVPKLLEGRDYVVRIYAENLYGISDPLISDEMKAKDRFS
VPDAPEQPIVKNVTKDSALVTWNRPRDGGKPITNYILEKKETMSTRWTKVTQEPIYPDTQ
FRVPDLLEGCEYEFRVAAQNEIGIGDPSPPSKPIFAKDPIVKPSPPINPEAVDKTKNSVD
LSWQPPRHDGGGKIIGYLIEYQKVGDEEWKKANYTADSCPDTKYSVTGLTEGTKYKFRIM
AVNAAGESEPAYVRDPVEIKDRLEPPELILDANMAREQHVKVGTTLRLSAVIKGIPFPKV
TWKKEDKEVSTKADIEVTKVGSKLEIRNAAHEDGGIYSLTVENPLGSKTVSVKVVVLDKP
GPPRDFEVSEVRKDSCYLTWKEPEDDGGSVITNYVVERKDVAAAQWLPISSSSKKHSLLA
KYLMEGTQYLFRVAAENQYGRGPFVETHKPIKAMDPLHPPGPPKNLHHVDVDKTEVSLAW
NWPDRDGGAEITGFLVEYQEEGTEDWTKFKTVPVPECVVTGLQQGKIYKFRVKAQNIVGL
SLPDTTIPIECQEKIVPPSVELDVKLIEGLVVKAGSTVRFPAIMRGVPIPTAKWVTDNTE
IKSEGNYKIDTDNYSTILTIKSCTRKDTGEYLLTVSNLAGSKTVAVHLTVLDVPGPPTGP
IDIVEVAPDHMVIAWRPPKDDGGSPVTNYIVEKRESKKETWGVVCSSLSQTRLKIPRLQK
GAEYIFRVRAENKIGIGPPLDSQPAVAKSMFDPPSPPGKPTVHDITENAATVNWTMPKSD
GGSPITGYILERREISGKWIRVNKSPVLDLKFRATGLYEGNTYEFRVFAENSIGLSKPSP
VSDPIKATRPISPPGPPINPKLKDKTRETAELVWTKPLKDGGSPILGYVVECLKSGTTQW
NRINKDELIRPCAFTVPGLIEGNEYRFRIKAANIVGEGEPRELPETVLAKDILTPPELEL
DVTCRDVITVRVGQTIKILGKVKGRPEPDITWSKEGKILTKDKRTDIIQEVPRIELQIKS
ATRADHGKYIIAAKNSSGHAQASAIVNVLDRPGPCRNLKVSYVTKDSCMIAFENPEDNGG
SEITNYIVEYRQPSQKGWSIVSSDLTKRMVKAHLIENHEYFFRVCAENKVGPGPVVETKT
PILAINPIDRPGEPENLHIAETGKTFVHLKWRRPDYDGGSPNLSYHVERKPKDSDEWERV
HKGSIKETQYMVDKCVENKIYQFRVQTKNEGGESDWVKTSEVVVKEEVQKPVLDLKLSGV
LTVKAGEPIKIEAGLKGKPQPEVSWSKDTEDLSKSPRVKIETTSHSSKLLLAKSRRTDGG
KYVITATNPVGSFVAYATVNVLDKPGPVRNLKVSDISTDRCKVSWDPPEDDGGCEIQNYI
IEKCESKRMVWTTYSSSVIMDSVQVTHLIEGNEYIFRVRAENKMGTGPPTETKPIIAKTK
YDRPGRPDPPEITRVSKDEMTVVWNPPEYDGGKSITGYILEKKEKRSLRWVPVTKTAIPE
RRKKVTDLIPGYEYQFRVKAENEIGIGEPSFPSRPAVAKDPLEPPGPPINLKVVDSTKMS
ITLGWGKPLYDGGAPIIGYVIEMRPKTEKAGPNEGWKRCNVAAQVIHTEFTVMSLDEKEL
YEFRVSAQNQVGIGPPADLKEAVSPKEILEPPEIELDASLRKLLIVRAGCPIRLFAIVRG
RPAPKVTWRRVGIDNVIRKGQVDLVDTMSFCVIPNSTRDDSGKYSLTLVNPAGEKAVFVN
VRVLDTPGPVADFKVSDVTKMSCQLSWTPPENDGGSPVTHYILEKREADRKSWGTLISDI
KKTSFKVANLVPGTEYFFRVTAVNEYGPGVPTDTPKPIMATDPLSEPDPPRKLEVTEITK
NSATLGWLPPLRDGGAKIDGYIISYQQEGQAGDHWTQYSVVKDLNIVVAGLKEGKKYKFR
VAARNAVGVSLPRETEGMFEVKEQLMPPKILMPDHIGIKAGQKLRIEAHVYGKPSPTCKW
MKADQDVLTSSRLAVHKADGTSVLIIKDVTRKDSDYYSLTAENSSGVATQKIKVVVMDIP
GPPQPPFEISDIDADACSLSWHIPLEDGGSNITNYVVEKCDVSRGDWITAVASVTKTNCR
LGKLTPGQEYVFRVRAENRFGISEPLQSDKMVARFPFDVPSEPKNARVTKVNKDCIFVAW
DRPDSDGGSPITGYLIERKERNSLLWVKANDTPVRSTEYPCANLIEGLEYTFRIYALNKA
GASKPSKPTDYVTARTPIDPPGKPEVIDVTKSTVSLVWARPKHDGGSKIIGYYVEACKLP
SAKWVRCNSTPHQIPQEEYTATDLEENAQYQFRAIAKTAVNISAPSEPSDPITVQSENVP
PKIELGVGMKSLLVVKAGTNVCLEANVYGKPMPTITWKKEGEVLKPVEGIKITTKRNLST
VELFSVIRKQTGDYTITAENASGSKSATIKLKVLDKPGPPASVKITNMYADRAMLSWEPP
LEDGGSDITNYIVDKRETSRPNWAQVTANVPITSCSVEKLIEGHEYQFRISAENKYGVGD
PILTENAVAKNPYDVPGPCDPPIISNITKDFMTVSWKAPADDGGSPITGYIVEKRETKAL
NWTKVNRKPVIERMIKATGLQEGTEYEYRVIAFNKAGPGKPSGASKAAYARDPQYPPGPP
AFPKVVDTTRSSISLSWSKPAYDGGSPIIGYLVEVKRVDTENWVRCNLPKNLPDTHYVVT
GLTENTEYQFRIYAVNKIGYSDPSDVPDKHLAKDILIPPEGELDAELRKVLVLRAGVTMR
IYVPVRGRPPPKIFWTKVDANIRDRAGMDIKSTDFDTFLRCENVNKYDAGKYVLHLENSC
GKKSYTIVVKVLDTPGPPINLVVKEASKDSAFISWEPPLIDGGSPVKNYVVEKRDAERKS
WSTVATECPKTSFRISNLEEGKSYFFRVFAENEYGIGDPCETRDAVKASETPGPVVDLKA
PQVTKSSCNLTWKKPISDGGSRINAYIVELLTGENQWQEVMRSITLHYSTKDLKEGKEYL
FRVRAQNEAGYGTPNEITVLARDDIVAPDLDLRDLPGLCYLAREGSSFRLKIPIKGKPVP
TVTWRKGEDLPLTETGRVAFEATAVNTSLLVRDCHKSDAGKYTITLKNVAGSKEGMISVK
VVGKPGIPTGPVKFEEVTADAMTLKWAPPKDDGGSEITNYILEKRDNVNNKWVSCVSAVQ
KTTFRVTRLHEGSEYTFRISAENKYGVGEGLKSEPVIARHPFDVPDAPPPPKIIEVRHDS
ASLTWTDPKKTGGSPITGYHLEFKERNSILWKRANKTPLRMKDFRVTGLTEGLEYEFRVM
AINLAGVGKPSLPSEPIVALDSIDPPGKPEVISVTRNSVTLVWTEPKYDGGHKLIGYIVE
KRDLPSKTWMKANHVNVPECAFTVTDLYEGSKYDFRIRAKNTAGAISPPSEPTGAITCKD
EYEAPTIVIDPTIKDGLTVKAGDTIAMSAISILGKPLPTSVWSKAGKDFKPSETVHIEST
PTSSALTLKYAARKDSGEYTITATNPFGTKEEHVHVKVLDVPGPPGPIEVSNVSAEKATL
TWTPPTEDGGSPIKSYVLEKRETSRLLWTQVAEDIQSCRHVVSKLIQGNEYLFRVSAVNQ
YGRGEPSQSEPVKMVDRFGPPGPPGKPETSNVTKNSVTVSWKRPIDDGGSEITGYHLERR
EKKGVRWIRVSKKPVSDLRYKVTGLLEGNEYEFRVSAENRAGIGPPSDISQPVLIKDAAY
PPGPPANPRVTDTTKTSASLAWGKPHYDGGLDIIGYIVEHQKEGEETWVKDTTGTALRIT
EFVVANLHPGVKYNFRISAINAAGVGEPALIPNVEIREREVSPDFELDAELRKTLVVRAG
LSIRIFVPIRGRPTPEITWTKDDIPLKARANIENTDSFTLLIITECNRYDAGKYLMTLEN
AAGKKTGFVNVKVLDTPGPPINLKPRDISKDSITLQWDMPLIDGGSRITNYIVEKRESTR
KSYSTITTKCPKCSLRIPGLAEGCEYYFRVFAENEFGIGEPAETAEPIRASEAPSPPDSL
NIMDITRNSVSLAWPKPEHDGGSKITGYVIEAQKKGSTQWTHITTVKTLECVVKNLTENE
EYTFQVMAVNSAGRSDPRESRPVVVKEQMMLPEFDLRGIYQKTIIARAGDNIKVEIPVLG
RPRPTITWKKEDQLLKQTQRINYENTATATILNINECTRNDSGRYPVSAKNIVGEVSEVI
TVHVHDVPGPPTGPIRFEEISSDFVTFSWEPPLNDGGVPISNYVVEMRKTDSTSWAELAT
TVIRTTYKAAHLTTGTEYQFRVKAQNRYGSGPAINSENVIASYPFKVPGPPGTPQIIAVT
KDSISISWHEPLTDGGSPILGYHIERKERNSILWQTISKALISGNTFKSSGLMDGIAYEF
RVIAENLAGKSKPSKPSEPTLALDPIDPPGKPIPLNITRHAVALKWTKPEYNGGFKITGY
TVEKRDLPNGRWLKANFSNILETEFTVSGLTEDAAYEFRVIARNAAGAVSQPSEPSDAIT
CRDEIEAPRIMVDAKYKDTLVVKAGEIFKLEADVAGRPPPTLTWTKQDKELEDTAKLEIK
IADFSTVLTNKDSTRRDGGAYTLTASNPGGFAKHIFNVKVLDRPGPPEGPLSVSDVTIDK
CVLTWLPPLDDGGASIDHYVVEKRETSRLAWTSVATEVPVTKLKVTKLLKGNEYVFRVMA
VNKYGVGEALESEPVLAVNPYVVPGPPKTPEVTAITKDSMIVCWGHPDSDGGSPITNYIV
ERRDRAGLRWVKCNKRVVTDLRFKVSGLTEGHEYEYRIKAENAAGVSEPSPSSPFYKACD
TLFKPGPPGNPRVLDTSKSSITIAWNKPVYDGGSEITGYMVETALSDEDEWKIVTPPAGL
KATSFTIINLKENQEYKIRIYAMNSEGIGEPAQVPGTPKAEERMLPPEIELDAELRKIVT
LRACCTLRLFVPIKGRPAPEVKWSREHGESLDKAIIESTSSYTLLTVANVNRFDSGKYML
TIENSSGSKSAFVIVRVLDTPGAPQNLKIKEITMSSVTLTWEPPLIDGGSKIKNYIVEKR
EATRKAYSTVIANCHKTSWKVDMLQEGCSYYFRVLAENEYGIGLPVETSESVKVSERPLP
PGKITLLDVTRSSVSLSWEKPEHDGGSRILGYIVEMQSKGSDRWATCATVKVTEATIKGL
IQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDLVIPPAFKLLFTTFSVLAGEDLKVDVPF
VGRPKPTVTWLKDDVPLRQTTRVNEENTESNTVLTIKEACKEDVGKYLVKLSNSAGEATE
ILSIIVLDKPGPPTGPVKMDDITADSITVSWEPPKYDGGSSINNYIVEKRDTSTTAWQIV
SATVARTTLKVSRLKTGTEYQFRIAAENRYGKSTYLTSEPVVAQYPYKLPGPPGTPYVPE
VSRDTMVVHWNEPVSDGGSRIIGYHLERKERNSILWVKLNKTAIPDTKFKTTGLEEGLEY
EFRVYAENIIGIGKASKCSECYTAHDPCDPPGRPEPIIVTRNSVTLQWKKPAYDGGSKIT
GYIVEKKELPEGRWMKASFTNVIETQFAVTGLVENQRYEFRVIARNAAGVFSEPSESSGA
ITVRDEVEPPRISMDPKFKETLTVHATESFKIDADVYGKPLPSIQWLKGDKELTNTARLD
IKSTDFATSLSVKEAVRIDSGHYILLVKNVAGEKTASVHVKVLDRPGPPEGPVVITGTTA
EKCMLSWKPPLQDGGSDISHYVVERRETSRLVWTLADANVQTLSCKVTKLLEGNEYIFRI
MAVNKYGVGEPLESEPVLAKNPFVVPLPPKAPEVSAVTKDSMIVVWDRPASDGGSEILGY
VLEKRDKEGIRWTRCNKRLISELRYRVTGLLENHDYEYRVSAENAAGLSEPSPPSIYYKA
CDPIYKPGPPNNPKAIDVTRSSVFLSWGKPIYDGGSEIQGYIVEACDVSVGEWAICTPPT
GIKKTNMEVEKLLEKHEYKFRICAVNKAGVGEHADVPGTILVEEKLEAPDLDLDLELRKV
INVRAGGSLRLFVPIRGRPTPEVKWSKVDGDIREAAIIDSTSSFTSLVLDNMNRFDSGKY
TLTLENSSGTKSAFVSVRVLDTPGPPVNLKIKEITKDSVTISWEPPVIDGGAKIKNYIIE
KREATRKSYAAVVTNCHKTSWKIDQLQEGCYYYFRVSGENEFGIGLPAETSDPVKVAEVP
QPPGKITVDDVTRNSVSLSWAKPEHDGGSKILQYIVEMQVKGSDKWSECTRVKVLEAVIT
NLTQGGEYLFRVMAVNEKGRSDPRSLAVPITAKDLVIEPDVRPAFHSYSIQVGQDLKIEV
PIFGRPKPTVSWSKDGIPLKQTTRVNVIDSPNLTVLNIKETNKEDNGIYEISVANVVGQK
SASIEVITLDKPDSPKGPVKFEDISAESVTLSWNPPVYTGGCQVTNYIVHKRDTTTTSWE
VVSATVARTTLKVTKLKTGSEYQFRIFAENRYGQSFALESEPVVAQYPYKEPGPPGTPFV
TIATKDSMIVQWHEPINDGGSRILGYHLERKERNSILWTKVNKTIIQDTHYKATNLEENI
EYEFRVSAENIVGVGKASKVSECYVARDACDPPGCPEAIVVTRSAITLQWTKPEYDGGSK
ITGYIVEKRDLPDGRWMKASFTNIIETQFTVTGLTEDQRYEFRVIARNAAGAVSKPSDST
GPITAKDEVELPRISMDPKYKDAIVVTAGDTFKLEADVHGKPIPTIMWLKGDKVLEDTAR
YEIRNTDFKALITVKDAIRVDGGQFILQATNVAGTKSVPVTVKVLDRPGPPESIQISGVT
SEKCSLAWVPPIHDGGSDISHYIIEKRETSRLAWTVVASDAVATMLKVTKLLEGNEYIFR
IMAVNKYGIGEPLESAPVLMKNPFVVPGSPTYLEVTNVTKDSMTVSWHRPDSDGGSEIIG
YIVEKRDRTGIRWVKCNKRRITDLRLRVTGLTEDHEYEFRVSAENIAGIGEPSQVTPYWK
ACDPMFKPGPPTNAHVVDTTKNSITAAWGKPIYDGGCKILGYIVEICKADEEEWAMVTPQ
TGLRINRFEIKKLIEHQEYKLRVCALNKIGVGEPAAIPGTIKPEDKLEAPELDIDSELRK
GIVVRAGSSVRINIPFKGRPTPEITWSREEGEFTDKVQIEKGINYTQLSIDYCDRNDAGK
YILKLENSSGSKSAFVTVKVLDTPGPPQNLIVKEIRKDYAVVTWEPPANDGGAKIKNYVI
DKRESTRKAYANVSAKCNKTSFRVENLTEGSIYYFRVMAENEFGIGSPAETADASKASEP
PLPPGKVTLTDVTQRSASFMWEKPEHDGGSRILGYIVEMQSKGSDKWTVVTESKVCNAVV
SGLISGQEYQFRVMAYNEKGKSDPKPLAVPVIAKDQTIQPSFKLMFNTYTVQAGEDLKVE
IPFIARPKPTIAWEKDGQPLKQTTRLHVEDTATSTTLFIKESNKDDFGKYTVTATNTAGT
ATEHLSIIVLEKPGPPQGPVRFDEVSSNFVVLSWEPPAYTGGCQISNYIVEKRDTTTTVW
QMVSAMVARTTIKVTKLKTGTEYQFRISAENRYGKSSALDSKPVLVQYPYKVPGPPGTPY
VTTATKDHMIVQWHEPVNDGGSKVLGYHLERKDKNSILWAKVHKALIQDTKYKTDGLEEG
LEYEFRVSAENIVGVGKVSKCSELYVARDACDPPGRPDAIVITRNYVTLKWKKPEYDGGS
RITGYTVEKRELPEGRWMKASFTNVIETEFTVSGLVEDQRYEFRVIARNAAGSLSEPSES
TGPIIARDAIEAPRASLDPKYKDLIVVRAGETFALEADIHGKPIPDVKWSKDGKEFEEAT
ARMEIKSTIERTTLTVKDCVRLDGGQYTLTLTNVGGTKAIPITVKVLDRPGPPEGPLKVT
GVTAEKCYLAWGPPLQDGGASISHYIIEKRETSRLSWTQVSSDVQALNHKVTKLLSGNEY
IFRVMAVNKYGIGDPLESEPVLACNPYKPPGPPSTPEASAITKDSMIVTWCRPIDDGGAE
IEGYILEKRDKDGIRWTKCSKKRLTDLRLRVTGLTDGHFYEFRVSAENAAGIGEPSEPSI
FYRACEAIYPPGPPNNPKVTDTSRSSVSLAWGKPTYDGGAPVKGYIVEFKEATADEWTTC
TPPSGLQGRQFTVTKLKENSEYNFRICAMNSEGVGEPATIPGSVVAAEKMEPPEIELDAD
LRKVVTVRASGTLRLFVTIKGRPEPEVKWEKAEGTLSDRAQIEVTSSYTMLVIDNVNRFD
SGKYNLTLENNSGKKTAFVNVRVLDTPSAPVNLTVREVKKDLVTLAWEPPLIDGGAKITN
YIIEKRETTRKAYATITNNCSKNVFRIEQLQEGCSYYFRVLAANEYGVGLPAETSEPVKV
SEPPYPPGKVTLVDVTRHSATIKWEKPESDGGSKITGYVVEMQTKGSEKWSTCIQVKTLE
ATISGLSMGEEYTFRVCAINEKGKSDPRQLGVPVVAKDIEIQPSVELLFNTFSVKAGEDL
KIDVPIRGRPVPSASWKKDGMPLRETTRVHVQTSKTSTLLVIKEASREDVGKYELNVVSS
AGSTTAIINVIVLDRPGPPTSLHIDNVSADNISISWEPPEYDGGCQINNYIVEKRETTTT
TWSTVSAAVARTSIKIARLTTGSEYQFRVSAENRYGKSTYVETAPVVAEYPFNLPGPPST
PRVVHATKAFMIVNWQEPVNDGGSKVLGYHLERKERSSILWTKVNKILLSDTQMKVTGLD
EGLMYEYRVYAENIVGIGKCSKSCEPVAARDPCDPPGQPEVTNITRTCVSLSWTKPEYDG
GAKITGYIIERKELPDGRWLKCSFTNIQETFFDVTGLTEDQRYEFRVIARNAADQFSEPS
DSTGPVTVKDDIEAPRIMMDAKFRDIVIKAGEILKVNADIAGRPLPIVSWTKDGKEIEEK
ARIEIVSTDRSTTITVKDCIRRDSGQYVLTLQNVAGTRSLAVNCKVLDRPGPPAAPLEIK
GLTAEKCYLSWGPPQENGGAEIDYYIVEKRETSRLAWTLCEAELPTTSCKVTKLLKGNEY
IFRVMGVNKYGVGETLESEAVKALDPFTIPSPPKSLEVTNVTKESMTLCWARPDSDGGNE
ISGYVIERREKNSLRWIRVNKKPVYDLRIKSSGLREGCEYEYRVYAENAAGLSLPSDPSP
LIKAEDPVFLPSPPSRPKIMDHTRSHITIGWIKPLFDGGAPIIGYTVEYKLTSETDWSTA
IQSLRGTEYTVIGLTSGAEYVFRVKSVNKIGASDPSEASEPQVAKEREEEPVFDIDNEMR
KTLVVKAGDSFTMTVPFRGKPIPNVLWSKPDTDLRTRANIDSSDNRTSLTVEKATRDDSG
KYTLTLQNIVNTATLTLLVKVLDSPGPPSNIIVKDVTKESAVLSWEAPENDGGAPVKNYY
IEKREASKKAWVTVTNNCHRLSYKVANLQEGGIYYFRVSGENEFGVGVPIETKDGVKITE
KPSPPEKLGVSSITKDSVSLVWLKPEHDGGSRIIGYLVEALEKGQQKWVKCAVVKTTHHI
VQGLKENMDYFFRVFAENEAGLSDPRELLLPVTVKEKMESPEVDMKGFPNHTVYVRAGSN
LKVEIPISGKPLPKVTLSRDGIPLKPTMRFNTETTAECVIINLKESMATDAGKYDITAAN
SSGTTKSFIKIVVLDRPGPPIGPVVVSDITEEGVTLKWEPPHYDGGSQVTNYIVLRRETS
TAVWSEVSATVARNMIKIMKLTTGEEYQFRIKAENRFGISDHLDSACVVIKLPYTIPGPP
STPWITNVTRESITVGWHEPVSNGGSAIIGYHLEMKDRNSILWKKVNKMIIRTTHFKAST
ITAGLIYEFRVYAENAAGIGKPSHPSDAVLAIDACEPPRNVRVTDISKTFVSLSWTQPAF
DGGSKITGYIVEKRDYPNGRWAKASFTNVIETQFTVSGLTQSSQYEFRVFAKNAAGSVSN
PSDVLGPITCVDTYGAPEIDVPPEYTEVVKYKAGTAVKLKLGISGKPIPSIEWFRNGKEV
QTSAQISIENTTEFASILIKDATRLNSGSYELKLKNAMGSASATIKVQILDKPGPPCGPV
HFKTVTAEKISLLWEPPADDGGAKVTHYVVEKRETSRVVWSMVSEKQEECDVTTTKVIKG
NEYVFRIRAVNKFGVGDALESESVVAKNRFVTPGQPGVPEITMITKQSMTVSWTRPTVDG
GSEISGYYLEKRDKKSLGWFRVVKETVRDTRQKVTGLTENSEYQFRVSAVNAAGQGPFSE
ESDFFKAADPIEKPGPPVKLKVVDTTKTSITLSWTKPAYDGGSAITSYAIEKREGDEEEW
SIVSARGEVRTTEYVISQLQPGLNYYFRVAAINCAGQGEPIEMTEPVQAKDILEEPEIDL
DVVLKTSIVAKAGQDVQIMIPFKGRPPPTVVWRKGDKNLSVDERYIIQNTESSTLLSIPQ
VTRNDTGKYTLTIENGVGKAKTSFVNVKVLDTPSACQRLHLKNVSRGTVTMVWEPPLING
GSEVTNYVIEKRDATKRAWSSVTAKCSNTSFKISDLSEKIPYFFRVLAENENGLGEPCET
LEPVKAAEVPGPVRDLIMKDSSKTSVTLQWTKPEFDGGSIISEYIIEKRLKDETEWSYAG
ISKACEFEVEKLKELSVMDFRVSAKNEKGRSDGVTIGPITVKDYVITPEADLSDIPGGQV
TVRIGYNVHLELPYKGKPIPSMSWLKDNMPLKESELVRFKKTENKITLSIKNVKKENGGK
YTLILDNVVHRKSFPFTVITLGPPSKPKGPIKLDEIKADSVILSWNPPEDDGGGEITGYS
VEKRETSQTNWKMVCSSVSRTTFKVPNLVKDLEYQFRIRAENRYGVSPPLNSVEVIAKHQ
FKPPGSPGKPVVYNITADGMTISWDAPLYDGGAEITGYHVEKKERNSILWQKVNISSISG
REYRITGLMEGLDYQFRVYAENSAGLSPASDPSKLHLAVSPVDPPGTPDYIDVTRETITL
KWTAPVRDGGSKIAGYSVERRQGPEDRWVRCNFIDVSECQYTVTGLSPGDRYEFRILARN
AVGTISPPSQSSGYIMTRDDAVAPNIEFGAEHFEGLTVKAGESIRLKALITGRPVPQVTW
FKDGEEIDKRLGVEITSAIGYSTIFVRDASRDHRGVYRVEAKNSSGTKQANLTIRVQDTP
GKIGGPIRFTNITEEKATLWWEPPANDGCAAITHYVIEKRETSRVSWALIEDHCEACSYV
ALRLIKGNEYQFRISAANKFGVGRPLESDPFVAQAHYTVPDAPGTPEPSNVTGNSITLTW
TRPKSDGGSDIDQYILERREKKSILWVKVSSKRPISETRYRVTGLTQGNEYEFQVMAENK
AGVGPPSGVSRLIKCRDPVHPPGPPTVVKVIDTSKTSVTLEWTTPVFDGGLEIIGYIIEM
CKADLGDWHKVNAETLIATKYTVTDLEPNEHYKFRVSAVNTAGKGESCEVAASVQTVDRL
SSPELDIDASFKQTHIIRAGTNIRLFIAFKGRPVPIATWSKADSDLNLRANIHTTDSFST
LTVENCNRTDAGKYVFTVENNSGSKSIAFTVKVLDTPGPPGPITFKDVTRGSITLMWDAP
ILDGGARIHHYVVEKREATRRSWQVVNEKCTRQIAKVTDLAEGVPYFYRVSAENEYGLGE
PCELTEPVVATEEPAPPKRLDIIDTTRSSVVLAWLKPDHDGGSRITGYLLEMKQKGTEVW
REAGQTKQLTFTVEGLTENNEYEFRVSAKNDAGYSQPREAFSSVIIKEPQIEPTADLSGI
TKQLITCKAGSTFTIDIPISGRPIPKVTWKLEEMRLKETDRVTIKTTKDRTTLIVKDSMR
GDSGKYYLTLENMAGMKTFTVTVIVIGRPGPVTRPIEISSVTAESCVLSWKEPEDDGGTD
ITNYIVEKRESGTTAWQLINSSVKRTQIKVTHLTKYMEYTFRVSSENRFGVSKPVESVPV
VAEHPFVPPSPPTRPEVYFVSANAMSIRWEEPYHDGGSKVVGYWIEKKERNTILWVKENK
APCFECDYKITGLVEGLEYQFRTYALNAAGVSKASEASRPIVAQNPVDPPGRPEVTDVTR
SSVSLSWTSPLYDGGSKIVGYIVERKPYHLTGDGRWLKCNYTIVSENFFTVTALSEGEEY
EFRVLAKNSAGVISKGSETTGPVTCKDEYSPPKAELDAKLKGDIVTVRAGSDLVLEASIG
GKPEPKVFWSKGDKELDLCEKISLQYTSRHAVAIIKFCDRSDTGKYTLTVKNASGTKQVS
VLVKVLDSPGPCAGKITISRVTEEKCTLAWNAPQEDGGAEITHYIVERRETSRLNWVIVD
AECATLSCVTTRLIKNNEYIFRVRAVNKYGPGVPLETEAMIARNSFTIPSPPGMPESVGA
GKEHIIIQWLKPESDGGNEISTYLVDKREKRSLRWTRVNRDYTIYDTRLKVTGLMEGSEY
QFRVTAVNAAGNSEPSEASQYILCKEPSYTPAPPSPPRVVDTTKTSISLAWTKPMYDGGV
DILGYILEMKEEGMDQWYRVHTTATIRNPEFTVTGLRQSQKYRFRVAATNINGISEYSES
PAEIEPVERLEIPDLELADDLKKTVTVRAGGSLRLMVSVSGRPLPRITWSKAGVDLASRA
IIDTTDSYTLLVVDKVNRYDAGKYVIEAENQSGKKSATVLVKIYDTPGPPGSVRVKEITK
ESVTITWDVPAIDGGAPVNNYIIEKREAAMRAYKTVTTKCNKTIYRISGLMEGALYYFRV
LPENIYGIGEACETSDTVLISEVPSVPQKLEVVDITKSTVSLAWEKPQHDGGSRLTGYVI
EASKVGTDRWMKVVTLKPTVFEHTIISLNEGEQYLFRVRAQNQKGVSEPREIVTAVTVQE
QKVLPTIDLAGIPQKTIHVPAGRPIELAIPISGRPPPAVSWFFAGSKLRESERVKIETVA
KLTKLTVRETTIRDTGSYTLELKNTTGTVLDIVKVIILDKPGPPIGPIRVVDIDSTFVTI
SWEPPEMDGGATLSGYVVEQRDAHRPGWLPVSESVTRTTFKFSKLTESAEYVFRVAATNR
FGIGSYLQSEIIECKSRISIPGPPGTLEVFDICRDGMTLTWYPPEEDGGSQISGYIVERK
EVRSDRWVRVNKIAVTMTRYRSTGLIEGLEYEHRVTAINARGTGKPSRASKPAVAMDPIA
PPGKPQNPRVTDTTRTTISLAWSPPEDEGGSKVTGYLIEMQKIDQFEWTKCNTTPTKIRD
YTLTHLPQGAEYRFRIAACNAGGPGEPAEVPGTAKVTEMLEYPDYVLDAKYLEGVFVRQG
GVIKLTVPIKGKPIPICKWTKEGHDVLQRAMIATSETDTELVIKDAEREDSGTYDLTLEN
KCGKKVVYIKVRVIGIPNPPEGPLEYDDIQGRSVRVSWKPPTDDGGADLLGYIVERREVP
KTAWYTVDSRVKGTSLVVKGLKENVEYHFRVYAENQFGVSRSLKSEEPVVPKTPLNPPEP
PSYPPEILDVTKSSVSLSWSRPRDDGGSRVTGYYIERKETSTDKWVRHNKTHITTTMYTV
TGLVPDAEYQFRIIAQNDIGEGEPSPASEPVVCKDPFDKPSQPGEIEIISIFKDSITLEW
ERPECDGGKDIIGYWVEYRQYGQTAWKKCNKERIKDRQFMVGGLLEATEYEFRVFAENET
GISRPRRTAMTVKTKLTSGETPGVRQEIKDVTTNLGETGQLSCQIIGRPLPDIKWYRFGK
ELVQSRKYKMSSDGRTHTLSVLTEEQEDEGLYTCKATNDVGEIETSGKLLLHAPPQFHPG
FPLKEKYRAGIGSTLRLHVVYIGRPVPAITWFHDKKLLKNTENITIENTEHYTHLSIKNV
QHKTHAGKYKVQLSNIFGSVDTVLSVEIQDKPDKPVGPIVVEALLKNSAVISWKPPEDDG
GAFVTNYVVEKREAKEGAEWQLVSSSISGKTCRIVNLIENAGYYFRVSAQNVFGISEALE
VSSVVIIKTPFEKPGQPTQPNVSAITKDSCVVSWRPPASDGGSKIRNYYLEKREKKQNKW
IAVTTEEIHETVYSVTSLIEGLEYEFRVKCENLGGESEWSEISQPIIPKSDISIQAPHFK
EEIRNLNVKFRGHATFVCKVTGHPKPVVKWFRQGKEIMPDGEKVKIQEFKGGYHQLVITD
VTDDDATVYQVRATNQGGSISGTASLDVEVPAKIHLPKNLEGMGAVHALRGEVVSIKIPF
SGKPDPVITWQKGQDLIDTNGHYQVIVTRSFTSLVFPNGVDRKDAGFYIVCAKNRFGIDQ
KTVELDVADVPDAPRGLKASEVSRDSVNLTWNAPANDGGSRITHYTVEKRATTAERWIRV
GQARDTRYTVVNLFGKTSYVFRIIAENKFGQSQPSEPTDPVITKEDKTKVINYDEEVDEA
REVTTAKAAHSSTKELYDRYMIAEELSRGQFGIVHRCVETASKKTYLAKFVKVKGADQVL
VKKEISILNIARHRNIMYLHESFESLEELIMISEFISGADIFERLNTPGFELNEREIVSY
VRQVCEALEFLHSHSIANFDIRPDNIIYFTRRSSTIKLIEFGQARQLKPGDNFRLQFTSP
EYYGPEVHQHDLVSTATDMWSLGILVYVLLSGLNPFLAETNQQTVDNIISAEYNFDDEAF
KDISIEALDFIDRLLVKERKSRMTATEALNHPWLKQRTEKTSTKVIKTLRHRRYYQTLVK
KEWSTVISTARISWGGAVRSQKGVTVAKVKVASIDIGPLSSQIMHAVGEEGGHVKYVCKI
ENYDSATQVNWYFGVKQLENSEKYEITYHEGIATMYVKDIAKADDGTYRCKVVNDYGEDS
SYAELFVKGVREVSDYYRCRTVKKVKRRIDTMRLLEKPPEFTLPLYNRTAYVGENIRFGV
TITVHPEPRVTWFKSGQKIKPGDDDRKYTFETDKGLYQLLIHNVNEEDDAEYTVLARNKY
GEDSCKAKLTVVHHAPAEATTLRPMFKRLLANAECQESQHVCFEIRVSGIPKPTLTWEKD
GQPLSASPNIEIVHEGLDYYALHIRDTLPEDSGYYRVTATNSAGSASCQAYLKVERLRYV
KRAYKSEEEKQKVVQKRIDKTVRMAEILSRTESVPLTQVAQEALREAAILYKPAVTTKTV
KGEFELKKEEIKEEKRLRMPYEIPEPRRRMATALEEDQNIKLFVPMSDMKWYKKLRDQYE
MPGKLDRIVQKRPKRIRLSRWEQFYVMPLPRISDQYKPKWRIPKLSQDDLEIVRPARRRT
PSPDYDFYYRPRRRSLGDLSEEELLLPVDDYLAMKRTEEERLQLEEELELGFSASPPSRS
PPRFELSSLHYSAAEAQRAAELSRKRELRYASYHIPSKEDTTATYAQLRQRHDRAAYRLS
KQKERIMAEKEDEELLRPVTTRQRLSEYKSELEYMSQEEKRRLRRRREKEITEITSKEEE
EEIEMVRHVHREYSPPSRLLRRRRSLSPTYIELMRPVSELIRPHSHPVEEPERRSPTPER
TRPRSPSPVSSERSLSRFERTARFDIFSRYESMKAALKTQKTMERKYEVLTQEPFTLDHT
PRITLRMRSHRVPCGTNTRFILNVQSKPTAEVKWYHNGIEIHESHKIHSTNTSGVLTLEI
LDCHIDDSGTYRVVCTNYRGECTDYATLDVTGGDYTTYSSQRRDDEVPRTVIPDLTRTDT
YAISSFKKISETEASSSVREVKSELTATRESLSSYERHASAEKKISASEKKSIEEKAVHR
KFKTTLPATILTKPRSITVSEGETARFSCDTDGEPTPTVTWLRGGQVLASSGRYHVTCTE
YKSTFEISSVQISDEGSYTVVVENSEGRQEAHFSLTVQQKRVPEKAVTSPPRVKSPERHV
KSPDRVKSPKRVKSPEPSPAPSKAKSTAAEKTAPAEKTDLPVAKSTAAEKTPPAEKTDLP
VAKPTAAEKTPPAEKTDLPVAVAPKITQQLKVDVSGDKVKLFCSAESSVLSVREVSWYKD
GKKLKEDDRFKLHYAADGTYELNIHNLQDSDQGEYTCEIIGEDGSSKTSFQFTGQAFKNA
STQISSLAKTQKLVQKEAEVLELSTQKKATVTSQEKAVVQEEIVKKSLISEDIKKPYPEV
KATTSKMSVSAGQRTVLKANISNASDVKWLLNGVELANSEDYRYGVSGSDHTLTISKATQ
KDEGMLTCEGKTEDGIIKCHFEMEVSKDLLNAPTFITQPRSQNVNEGQNVLLTCEVTGDP
SPEIHWFKDNQPIALSSNIQVNRSKNIYSLAIQNAALSDSGKYTVKAKNFHGQCSATASL
TVLSLIEESPKEVVLRSGEASMQESFSSQSIQMSASKQEASFSSSSMTEMKFASMSAKSM
SSMKESFVEMSSSSVTGKSSLTQMDSSTSSLLKSGMRGIPPKIEALPSDISIEEGKVLTI
SCAFSGEPAPEITWSRRGQNISSQGGRFHIETCEDLTTFIIMDVQKKDEGLYTLNLENDF
GIDSATVNINIRSM
NT seq 105885 nt NT seq  +upstreamnt  +downstreamnt
atgacaagcaaagcgccaacatttacgcagccgttacaaagtgttgtggcactggagggt
agtgccgcaacctttgaggctcatattagtggtttcccagttcctgaggtgagctggtat
cgggatggccaggttatttctgctgcaactctgcccggtgtgcagatctcatttagcgat
ggccgcgctaaacttgtgatccccgccgtgaccgcagataacagtggaagatatacccta
caagccaccaatggatctggaaaagccacaagtactgcagaactacttgtcactgctgaa
acagcgccacccaactttacacaacgactacagagcatgactattcgacaaggaagtcaa
gttcgacttgacgtgagagtgactggaatccctacacctgtggtgaagttctatcgggat
ggagcagaaattcaaagctcccccgattttcaaattttacatgaaggagacctctacagt
ttaataattgcagaagcttaccctgaagactccggaacctattcagtaaatgccactaat
agcgtgggacgagctacttcaacagccgaactgctcattcaaggcgaagatgaagctgtt
cccgctaaaaagacaaagacaattgtttcgactgctcagattacacaaacacgagaaacc
cgaaccgaaaagaagattgaagcccactttgatgccagaacacttgcaactgctgagatg
actatagaaagtgccactgggcagcagctgatccataaggcacccccacggatgattcct
caccctgcttctaaatcgcctactccaccaatcattgcagccaaagtacagatggcacgc
cagcaatcaccatccccaatcagacagtcgccatctcctgtacgccatgtgagagctcca
acaccatctccagtcagatcggtgtctcctgctggagttacaaggctctcagtctctacg
tcacctatcagacctgtgagatcaccaatcttggtccggaaaacacaggccacagcagca
atgggggctgatgtgcttcctccttggaaacaggaaggcttcgtagctacttcggaaacc
agaatgaaagataccagagtaactatgagcaccacccagatgaggactgaagaaagatgg
gaagggagatacggagtgcatgaacaggttgcaattagcggagctgctgcagcagaggct
acccttgcaattggtgctgctgctgctgctgctgctgccgccgctacagaggacgttgac
aaaacaacagctgttgctaccgtcgttgcagccgttgacatggccagagagagagaacct
cttccaagtgctgtagagcagatggctaaaaggacagccatggccgcagtacacattccg
cctgtccaggagcaggttaaaaaagaagctgccatagtaattactactgctgctgaaaaa
gccagagagcaagaaatgatattgagaactaaagaagcagttactacaaaacaagaacaa
atacagatcactgaggaaaagataagaaaagaaccagtgaaagttcctgtgcccagggta
ataattgctgctgacacaattaaagaacaagaactgatttcacgagctagagaagaaatt
cctacaagaaaggaagaaatttacattactcatgaaaagataagaaaagaagcagttaaa
gttcctgtgcccaaggtaataattgctcctgaattacttaagcaacaagaacagatttca
agagccagagaagaaatatcaaccagaagggaagaaatgcacatcgctcatgaaaagaca
aggaaagaagttgtgaagcccgtgaaaccttctgtacctaaggtagtaattacagctgac
aaacccaaagtacctgcaccagtagtaaaaacgacagagagaattgctaccaaacaagaa
gcacaagcccactttatccaagaaaaggtaagacaggagactgaaaaaattgccatagtt
ccgaaaatcattgaggttgataaacgcaagaaacaagatataatatcaagaaccagagaa
gacgttgctgtcaaaagagaacaaatccagctagttcatgaacagattgatgttgacaaa
aaggctgaagctgtagccacagttgtttatgcagttgaccaagcacgcattaaagaacca
agagaaccagattatgccgaagaagcttattctgaacaggcagctctggactatggatac
aaagaacatgctttagcaagacatgttgttgaggtaccaccagagccacatgttgtcacc
aaagaggtgaaaactgaggagattcgaattcctcctaaaatacatgttgcagctgctgaa
ataatggaaacggacatatcaacacagattaaaaggactgcagaaacatcatttgaaaaa
tcaatccatgtggaacacatacgtccccgtacagcaagccctcattttacagtttccaaa
attactgttcctaaaccagatcatacttatgaggtttccatagcaggctctgctatagct
actctgcaaaaagagttagcgacaacttctgttcctaagataaccaaatctgtgaagcgt
cctgttgcaaagtctcctgaacccagattgatgccagagaaagtcgcctctccacagttc
ccttttgtagagacacctgctgacacctatcagaggctttatggtgctgaaataaaaaga
gaaataggtgtgacggtgacaggtggactggtgcaggaacgcgaacacgtcgaattaatg
ccagcagctgaacccaaggtgatcgaagctgctagagttccaaaacctacagaagttccc
gctacacccccatatatcgtctcaatgctgaaaaatgtgactgttctggagggagagtcc
gtcaccctggagtgccgcatctctgcctatcctgctccaactgttgcttggtacagagaa
gactaccacattgaaagttccattgatttccaaattacctttgaggcaggagttgctcgc
cttgtgatccgagaagcttttgcagaggacagtggaaaatttacttgcacagcttccaat
gaggcaggaagcattagcacttcatgctacctccttgtacaagtctcagaggagtttgag
accaaagaagctgtttctgcaaaagaggtcattgaagaaagacgctatgtagagtccaaa
gatgtaataatggcagaaattgctgcagcagaagaagtacctggagaagctgcagctccg
ttctttataatgaagcctgttgtacagaggttaattgaaggtggaagtatcatttttgag
tgccaggttgggggcaacccaaagccgcatatttactggaagaaagctgggcttcctgtc
acttcaggctacagatacaaaatcattcataaaaaagaaactggggaatgcagacttgaa
atttctatgacttttgccgatgatgccggagaatatactattgttgctcgtaacaaacat
ggggaagtttctgcatcagctttcttattagaagaagctgattatgaggtctacctaaaa
tctcaagaagaaacaatgtatcaaactgaagtaactgcctatgttcaagaacccaaagta
gctgcagttgccccacccactttatatgctgactatgaaaaagaatatgaaaaagaacaa
gctctgattaggaagaaaatggcaaaagatactgtattaatcaggacatttgcagaggaa
caagagttccatatttcttcctttgaagaaagacttatgaaagaaattgagtaccggatt
attaagattacacttgaagaacttcttgaagaagatggagaagagatggtagttgacatt
cctgaatctgaaaccattgaagcaggatttgatttaagactaaaaaattacagaatcctt
gaaggaagtggcgtgaccttccattgcaagatgagtggctatcctttgcctaagattgca
tggtacaaggatggcaagcgtatcaggcatggagaccattaccacatggagatcatgcca
gatggcagagccagtctacgctttcctgttgtcttgcctgaagatgaaggcatttatacg
gcctttgccagcaacgtcaaaggaaatgccatttgctcagccaaattatatgttgagcct
gttggacctactgggtctccaggttatatcccatcacctgaaatgatgagaagatatcga
tctctttctcctcgatccccaagccgttctcctgcgcgtagttcgccttcacgctctcct
gcacgcaggctggatgagacagatgaaggacagctggaaagattgtacaagccagtattt
gtgctgaagccaacttcatttaaatgtgcagagggacagacagcaagatttgacctcaaa
gttgtgggtcgaccaatgccagagacatactggtttcacaacggtcagcaagttcttaat
gattatacccacaaaattgtgattaaggaagatggcacacagtccatgattattgttcca
gcaatgccttctgattcaggggaatgggttgtaattgctcaaaacagagcaggaaaagga
tccatttcaatgaccttgacagtggaagctaaggaacatttgataagaccgctgttcata
gaaaaactgaagaatacgagtgtcaaggaaggagataaactggaaatgaatgtgaaagcc
cggggaaaccctaatcctgacattgtgtggctaaagaacagtgacatcattgtaccccat
aaatatcccaatataaaaattgagggaacaaaaggcgaggctgccttgaagattgagtcc
actgtcagacatgatgctgcatggtatactgctactgccattaataaagccggacgtgac
actacacgatgtaaagtgaatgtggaagttgagtttgctgagcccgaaccagaaagaagg
ctaatcatccccagagggacatacagagcgaaagaaatcgcagcaccagaattagaacct
ctccatttgcgatatggtcaagaacaatgggaggaaggagacctttacgataaagaaaaa
caacagaagccatttttcaagaaaaagctcacttccttaaggctcaaacgctttgggcca
gcccattttgactgtagactcacacctattggtgatccaaccatgagagtagagtggcta
catgatggcaagcctttggaggcagccaacagacttcggatgattaatgaatttggatat
tgcagtcttgactacgatatttcctatcctagagacagtggtgtgattacttgcagagct
acgaataaatacggcacagaccatacgtcagcaactctcatcgttaaagacgagaaaagc
ctggttgaagaatctcagctgccagaaggcaggaagggacttcagcgcattgaagagtta
gaaagaatggcacatgaaggggccattactggcattgtagaagatgaaaaagtgaaacaa
aagccagacatagttttgtttcctgaacctgcaagagtccttgaaggtgaaattgcacga
ttccgctgtagggtgactggttacccacaaccgaaagtcaattggtacctcaacggacaa
cttgttcgtaaaagtaaaaggttcagacttcgctatgatggaatttactacctggacatt
gtggactgcaaaacatacgatacaggtgaagtgaaaatatctgcagaaaaccctgaaggt
tcagttgaacattcagtgaagattgaaatccaacagagggaagattttagatcagtactt
cgtcgagcacctgagcctaggcatgaagctccaacaacagagactggcaaacttttgttt
gaagtccaaaagattgacaaaccagttgaggcaactaccaaagaagtggtgaaactcaaa
aaggcagaaaaggtcagccatgagaaaatatctgaagaatctgaagaactccgcagtaaa
ttcaagcgtagaactgaggagggctactatgaagctatcactgctgtggagcttaagtct
cgtaagaaggatgaatcatacgaagatttgcttaagaagacaaaagaagaacttcttcat
tggaccaaggagttaacagaagaagaaaggaaagccctagaagctgagggcaaaatcact
attccaaccatcaagccagagaaagttcaacttagtccaagcatggaggctcccaagata
tttgagcgcatacaaagccagacgattagtgaaggaagggatgcccagttccgtgttcga
gtagtaggcaaaccagatccagaatgccagtggttcaaaaatggtgtgcagattgaaagg
tcagatcgcatctattggtactggccagaagataacgtttgtgagttggtcatcagagat
gtaacagcagaagattctgccagcataatggtgaaagctgtgaacgtagctggtgaaacc
tccagtcatgctttcttattagtacaagccaaacagcatataacattcatccaggagtta
caagatgtcaccgccaaggagaaagattcaatggcaacctttgaatgtgaaacgtctgag
ccctttgttaaagtgcaatggtacaaggatgggatagagatatgttctggagacaaatac
cgaacacattctgataggaagggtcatttcctttctatactaatgatcgacaagtttgat
gaagacgactacagctgtgcccttgtagaagatgaatctgtaaaaacaacagctaaacta
atcgtagaaggtgctgtggttgaatttataaaagaattggaggatatcgaagttccagaa
accttctcaggggaactagaatgcgaaatttcccctgaagatatggaaggaaagtggtat
cataacggcattgagctgacacccaataataaatatgtaatagcctcgcgccggggtcgt
cagatccttaccattaaagatgttgctaaagaagatcaaggagagtatagctttgtggca
gaagggaaaaagacctcctgtaaactgaagatgaaaccacgacctgtgaatatccttcaa
ggtctatctgatcagaaagtctgcgaaggtgatattatacaacatgaagtgaagctctcc
caggaaaatgttgaaggcgtctggatgaaggatggcgctgaaattcaatcaagtgatcgt
atccacattgtcatagataagcaatcccatatgctcctagttgaagacgctaccaaagaa
gacagaggagaatactcctttaacatccctagtctgcttcttgtaacatctggccatgta
tctgtctctagtgtggagataattgttcctctgaaagatgtccatgctattgaaggcaca
aaagccatccttgagagcaaaatttcagtccctgatgtatcttcctccaaatggtatata
aatgatgaacaaataaagcccgatgaccgtgtacaagcagtctccaagggcatgaagcaa
cgacttgtctttaccaggacatatgcatcagatgaaggacagtgtaaattagctgttggc
aaagttgaaaccagctgtaatctcataattgaaaaaattaagattattaaaggtcttcat
gatatcacctgtactgaaacccagaatgtcacctttgaagttgagctgtcccatgctgga
attgatgtgctgtggcattttaaggaccaagaaatcaaagccagccccaagtacaagata
gaggcacatggcacaatatataagctgacagtaatcaacatgatgaaagatgatgaagga
gaatacacattttacgctggagaaaagaagacctctgggacactggtggtagcaggtggt
gccatttcaaagccccttactgatctcacagtagctgaatcccagaaagctgtttttgaa
tgtgaagtagccaatcctgaatctgtaggccaatggctgaaagatggaaagccgcttact
atgacagatcgttgcaaaagtgaatctgatgggttgaagcggagacttattattccaatc
agcaaattggacgatgttgcggaatataccttccgagtggcatcttcaaaaacatcagct
aagctgaaggttgaaactgtcaagatcaaaaagacactaaagaacctgactgtgacagaa
acacaagatgcagtatttttaatagaacttactcacccagatgtgaaaggtgttcagtgg
attaaaaatggcgttgagctacatcctagtgacaaatatgaaatcaaagtggagggaacc
atctatacactgaaagtgaagaactgtgctgtagccgatgaatcagtttatggttttaaa
ctgggaagaataggagcaaatgcaagactccatgttgaaactgttaaaatcattaaaaaa
ccaaaggatgtgaccgctctggagaacgctgttgtttccttcgaagtgagcgtttctcac
gatgctgtgcctgtgaaatggttccacaaaaacgtcgagctcaaaccaagtgacaaatgc
agactgagttctcaaaggaaggttcataaactgaccctgcagaatatatctcctgctgat
gctggagaatacacagcaattgtgggacaacttgagtgcaaagctaagctttttgtggaa
acggtgcacattacaaagaccatgaaaaatattgaagttccagagactaaaactgcctct
tttgagtgcgaggtgtctcatttcaatgtaccttctgtgtggctgaaaaacggagtggaa
attgaaatgagcgagaagtttaaaatcgttgttcagggaaaactccaccagctcaacatc
gtgaataccagcagtgaagattctgcggaatataccttcatctgtgggaatgacaaagtt
agcgcaaccttaactgtcaaacctgtcctgattacgtctatgctgaaagacatcaatgca
gaagagaaagatacaatcacctttgaagtcactgtcaattatgaaggcatcacatataaa
tggttgaagaatggggtggaaataaagtccacggaccgatgccagatccgaacgaagaaa
cttacacattcactctcaataaggaatgtccatttcggagacactgctgaatacacgttt
gttgctggccaagcagcatcggcagcaactttatatgtggaagcccgccatattgaattt
agaaaacacatcaaagatattaaagtggtggagaagaaaagagctgtttttgaatgtgaa
atctcagaacctgacatttctgttcagtggatgaaagatggacaggaacttcagctgggt
gacagagtaaaagttcagcgggaacggtttgttcatcgtcttctgattacatccacaaag
atgtctgattcagggaagtacacagtagtggctggaggaaatatgtccaatgctaatttg
atggtggaaggacgtgatgttcgcatcagaagcccccagaaaaatgttcaggttcttgag
aggcagcgagctgttgtggagtttgaggtcaatgaagatgacattgatgctcactggtac
aaggatgggattgagatcaattttcagattgaggaaagatatcattatgaggtggaaaga
cgtgtccataagatgatcatcacagaaacgagatatacagatgctggagaatataccttt
ttagctggaaaaaataggagttccatcactctttatgtaaatgcacctgagccacctaag
attgtaaaggagcttcaaccggccactgtggagtctgggaaacctgccagattctgtgct
attgtgtcaggcaggcctcagcccaagattttctggtacaaagatgagcagcctctttct
ccaggctttaaagtaaagttccttcatgatgcccaagagtacaccttgttgctgattgag
tctttccctgaagatgctgccgtctacacaattgaggcaaagaatgactatggcattgcc
acctcttcagcatccctttcagtggaagttccagaagttgtttctcccgacgtagaagtg
ccagtttacccacctaccattattacaccgctccgtgatgctgttacatctgagggacaa
tccactttctttcagtgcagagttactgggacagacctcaaaatatcgtggtatagcaaa
gacaaagaaatcaagccatcccgcttctttaggatgacccagtttgaagacacataccag
ctggagattgcagaagcttacccagaagatgaaggaatttacacctttgttgccagcaat
tctgttggccaagtgtcaagtacagctactctcaggctggaagatctggaaaaagtcata
caggagaagatagagcagcagattgaattggaagttaaagagatgtctagctctgttact
gtgtctactaaggaagaaagcatcaagagtttcaacagtgacctacagttatatgataaa
aatacaacacatgaactcaggcctgaaaaatcaatttattccaacaatttagacaagaaa
gaggagaagaggaatattccaagcttcctcaaacacgtgtccaatgttgaagtcagtgta
ggagatctagctaaactttctgttactgttactggcaatccaaaacctcagatacagtgg
tttttcaataatgttaaaataacatcatctgcagactataaatttgtgtttgatgaggaa
agctacagcctcattattctttctgcaaactttgaacatgagggagaatatacttgcatt
gccagtaatagtcatggtgagacagcttgtagtgcttatctgaaagtaaatcctaaagga
ggtagcacagaatcagagataatcagggcagtttccacagagatgataggagggcctcaa
tctccacattttgtcagaaaactaaatcctgctcattttgtgcaaggtgctccagctgtg
tttgaatataatgttattggagagccagctcctataattcactggtttagaggaaatgat
caaattttctccggtgtacattacaccattatccataatccagatggttttgggtctcta
acggtgaataactgtcaaagggaagatggaggattatacttctgtaaagcaagcaatatc
ttaggtgaagccacaagtagtgccaaacttattattacccaagatattgaagatattgta
gatgttgctcataagactagtaatattgtggctgctacttcattaactgtgagtgaagtg
aaggagtattgtggcttcctagagcaacactcagaggccattcaaagctcaccactactt
caggtgtttagttctaaatgccctcagatttctgatatttgtttaccagttatggaagaa
gcaaaccgtgaagaaaaagaaaaacagttgccaatgaagctgccagaaataatcaatcca
gagtctgttcgggaagaaacatctccattaatttctattctttctgaagagaaatatggg
ataagcttggatgaatctctcatattctcagctccaaaagctgaagaagctatctcagcc
caagaaactaagcaagaggtatatatttctggagctgacagcatccaaaaattgtccaag
gaaagctctttagcagtccatgtacataagtcagagaagggggtactagtgcaggaagaa
cacagttgtttccagtccgttatagcaacccagcaatatgagatccatgaagctcttata
gggacaattaataacctggacacacttgaaaaggttcagccaacccaagaatcaatagag
gcactgcaggtccctctgattgcctctgaagagatattccccaaagaaaagacttttgaa
gcaactgtggaagagcttcaaaaaggctccctgaagcacgacaaccttgtgaaagcaaac
ctcatggcagaagaaaaacagaagctctcccacgagctcaccgaaagaattcctcagtta
gaaggcacagtcctagcagaggtacagaaggaaagtggaaatccgctgcatttgcccatt
gtgtttgaacaagcaacccttcctaaagaggagcattttagtactgaggtaccaccagaa
gatgaagtagtatctagcaaaagccaaagtctgcttcacagcttaatagtggaagagcag
cttcccaccacaagcgaagaagctaagcttctttcttccctgggggaagctgtcagtctg
cagcttgtcaaagagcccgtttctgtatcacatctccagatcaacaactctgagcaagtg
ttgtctaaggaagacattttgactttaccaaaacctgaatgtcaagctgcagtacagaaa
gcagaaagcatgattaagtgtaccgcgaattgggaggaacagagaccaatctctgcagat
acactggaggccactcggtatgggatcgctggagaaaaatctttggctacatcagagcct
cagctccgtaagtgtttgactgtcgtggcagaagagtggccactgcccaaagagcaaata
cttcctcaaatggacacggagaggaaagcagccctgaagaaggatgactctcagatggtt
atgcaggcttcagttatcactgaaacgagggccttggctgcagggcacattaagccattt
aaggatgttgagggcaagaattgtgggataacctctgagctcaaactagtgttggaatct
gtatgtgttgaagaatgtggtgttcctattgagaacgctgatctcttagaagccacaggg
caagattttgcagcacgaatccaagaaggacagtcaattaggctcccgttaatactagaa
gaaaaacagcctttcaaggaagaacacctaaaggaactcacaagcccagaaagtcaacat
acgacagtccacaaagaatcaagaatggtaatgggagtgccccaaactctggaaaaccaa
actctttctaaagaaagccaacttgcacaagaaactccagtgtgttgcagcctagatatg
aaacccccagtaagaagcgccttaaaaacagctctaataaatgaacatcattcattttct
ttcgacactttcaatgatatagaaaagattaaattaaaaaccataaaaatagtccaagaa
cctaaacataccttgttcatctgccttgttaccaaagaaagttcaaatactgcagaaata
agtcttccctttgacagaatatattctcataaggttactataagaaatgaattgcaacct
ccatttcagcctattatttatgaagagaaacacattctgatggcagatgaacccaaagtt
ataaaggaaactaaaagctacaatttgcttgttatttcttcacctttcagagaaatacat
tcaagtattgtaactgatatgcccattcaagagcaaacagttggggatctcactggttac
cctgagccccaatatgccagaattagtcctgaatccaaactacagctggagcaacttgtg
tctgcacaagaagtcaaaattcttgctctaaaggagcaaattaaagatgatagttcatca
atgcctgcctcagctgaaaaactaattttctttctaaaagtgggagaaagaaaagaagaa
cataacaaggagactcatttatttgaagctaaggaacaaaaaaatagaagtcccatccta
aacctaggtttgaaggacactgttgttgaggaaggtgatggggtacaatttacttccaaa
atagcaaatgctgaagtggtaaattggtattttgagagtaatctgatattttcagacagt
gagttcgagtgtttgcaagaacatgacacctatacactcataatcaaccaagcactaaag
gaagtacatcaaggggagtacacctgtgaggctctgaatgaaaatggaaaaactacagca
acagcaacactcacaattgtaaaaagagttgcacccatgctaagaagaaggttagaatcc
caagaggttgctgtgaaccatcttgccaagtttacttgtgagattgaaatggcaccagat
gtacgatttcagtggtacagagcaggacgggaaatctatgatggtgacaagtacaccatt
tatacagctaattacatatcgactctacaaattccaagacctcaagttgtggactgtggt
gaatacacctgcaaggcatccaaccagtatgggagtgtgagcagcagagctacattgaca
gtaactgaagcgtttcctccaacttttgtaaccagacctgaatctcttacaacttttgtg
ggtaagagcgccaggtttccctgcagtgtggcaggcacgcctgtgatagacaccgtgtgg
cagaaggacggcactcccatctcttccacagaacactacaaaattttagcatctgacacc
aagcatagtttagagattgcacatctcacaatcaatgacaggggggtatacagttgcaaa
gcctccaacaagtttggagcagacgtctgccaggcagaattaaccattatcgataagcca
cattttattaaggaactgcagtctgtgcagtctgcagtcaataaaaagatacgtcttgaa
tgccaagtggatgaagacagaaaagtaactgtctcctggactaaagatggccacaaaata
cctccaggcaaggattaccggatcatgtttgaagacaaaatagcatctcttgacatccca
ctgtccaaaattaaagattcaggcacatatacctgcactgccacaaatgaagctggaagc
agttcctcatctgcaatggtaaccataaaagagccaccatcctttgtgaaaaaagtggac
ccctcttacttgttgactccaggagagtcagcccatcttcagtgcaaaatcaaagggtct
cctgtgatccaggtgacatggttcaaaaataacaaagaaattagagagagtgatacatcc
aggatgtcctttgccaacaacgtggctgtgttagatatttccaacatgaaagtggacgac
agcggaagttactcctgtgaggcagttaatgatgctggcagtgacagctgtaacactgag
attgttgtaaaagaacctcctgccttcatcaaaactcttgagccagctgaactagtgcga
ggaacaaatgccattcttcagtgtgaggtttctggtaccggaccgtttgaaatctcttgg
tttaaagaaaagaagcaaattcgcagtagtaaaaaataccgcttggcttcccaaaagtct
cttatttctctggagattacttcattcaatagcgcagatgttggcgaatacgaatgctct
atagccaatgaagttggaaaatgcatttgcagtgcaacatacatactgaaagagcctcca
tcttttattaagaaagttgaagatgtgactacgcttgctggagagacaatctttttgcag
gcagttgtgaaaggctcagctcctctttctgttacttggatgaagggcaaagacattatt
aaagaagataacaaagtcaaaattacctttgaaaatggccttgccactttggaaatctca
ggtgtccaggttaattctagtggtaaatatacctgtctggttgagaatgatgcaggaagt
caaacttgttttggacaattagcagttaaagaacctgcaacaattgttgacagagcggaa
tttgtgcaggtgacagctggggacccagcaattttggaatacacagttgcaggcaccccg
gagttaaaaacaaaatggttcaaagatggaaaagccctggtttccaacaaaaagtataga
atcagttttaaaaacaatgttgcccagttaaaattctacacttcagaattacatgatact
ggggaaatcacctttgaagtttctaacgacgttggacggagtgcatgcaccaccacgttt
agcgtgatagatcgcactcttcctccattctttaccaaaactctgcggaatgttgacagt
gtggttgggggcacctgtcatttggattgcaaagtgtcaggctcgcttccaataaaggta
tcttggtttaaacatgacaaagagatcactcccagcgccaagtacgcaatacggtatgaa
gaaggctcagcgtccttggaaatcaagaagttggacaccaaggatgtaggcgtgtattct
tgtaaagccaccaattctgcaggcagtaaagaatgcagtagtgctttggctgtaaaagaa
ccacctagcttcataacggagccagaatctcaagaaatattgcctgggtcgacagtgcgt
ttgaagactacttttaaaggaacagcaccattctctgtgcagtggtttaagggtgatgct
aaattaaccactggaggagcttgctatatcatgactgaagccttctcaagctacctggaa
ctctatgcagtaaaacctgccaattctggtgtttatgcgtgcaaagtcagcaatacggct
ggttccattgaatgcagcgcacacttatttgtgaaagaacctgcttctttctcagaaagg
ctggagccttcactgttatttaagaaaggagaatatgcccagttggactgcaaagtaaag
ggtacccctgaactcaaaatctcttggtttaaggatgatcgagagattaaagagagtgac
aagtacaagatgactttgatggatgctacagcagtactcagtctgttggatgtcacaatt
gaagacagtggtgtatatatgtgtgaggtgaaaaatgatgctgggaaagagacatgcagt
agtatggtagcagtaaaagaatcaccatattttatcaaggaatttgaacccagggaagta
ttaagagactccgatgtaatactggagtgtgaggtcttaggtactcccccactggaggta
tattggctaaaggacaacaagcctgtgaggagtagcaggaagcacagaataaccactgag
aaatccttatttagcctccaagtgttcaagtttgattcttcagacgctggtgaataccag
tgcagggtaacaaatgatgtaggaagctgtgtgtgtagctctgaactggccctgaaagag
cccccacaatttgtgaagagaattgagaacattagctctctccagggaggcactgtagtg
tttcaggcaacagttaaaggctccatgccaataacaatttcgtggctgaaagacaatgat
gacattattgaagatgacaacacaaaaatgacttttttgaacaatgtggctactctcatg
atccgagccattgaagtgaagcatgatgggaaatatttctgtcaggcaaaaaatgaagcc
ggcatccaaagatgttctgctttgctaactgtgaaagaacctgccacaatcattgataaa
gctgtttccattgatgtcacggaaggcgaccccgctacattgcagtgtaaattttcagga
acaaaagacattagtgccaaatggttcagaggtgggaaggaactaacctttggccctaag
cacaagatcagtgttactgatacagtttccatgttaaagattgtctccacagaaaagaat
gatagtggtgaatacacatttgaggtttcaaatgatgttgggagcagcagctgtaaagct
agcattaatgtcttagatctgatcataccacctaaattcaccaaaaagctaaagaaaatg
gatagcataaagggatcttttgttcaccttgaatgtattgtatctgggtcacatccaata
agcatccagtggtacaaggatggccaggagataagtgctagtgaaaagcacaaatattct
ttccacgataatacagcgttcttggagatcaatcagctggaaggctcagacagtggatct
tacacttgtgaagcaacaaatgaagcaggacaaaaccagtgcagtgcatatttaactgtt
aaagaacccccaagcttcatcgagaaaccacaatcacaggatgttatacccgctgctaga
gtccaactcaaaactcttgtgagcggtacacctcctttacaaataaaatggatcaaagat
agcaaagaactcctttcgggggcctctcgctcagtgtataaggatgacacttcaagtgta
ttagaactcttttcagccaagctatccgactcaggaaattatatctgtcaaatcagcaat
gatgtcggatcaactacctgcaaagcaactctctttgtgaaagaaccacccaggtttata
cagaagcctagccctgtagtagttttgaggaaagggcagtctaccattttcgaatgccag
gtagccggcacacctaaaatccatgtggcttggtattttgatgggaatgaagtattcgac
tctgataaatacgaaatctcctttgtggacaacattgccactattaagatcatcaatgcc
atggtggaggatagtggaacttatatatgtgaagctcgtaatgatgcaggtagcaagagc
tgcagcactgaactgaaagtgaaagaacctcccacatttataagggagctgaagcctgtg
gaggtggtgaaaaggtatgatgctgtattggaatgtgaagtcacaggcaccccacccttt
gatgtgatctggctaaaaaacaacactgagattcgaagcagcaaaaaatataccatggtt
gataaacagtttatatttgcccttcaaacaatgaactgtgattcccaagatgctggtgaa
taccagtgtgttatatcaaatgaaggcggaagttgttcatgtagcacaaaagtcagcctg
aaagagcctccttcattcattaagaagatagaaaatatccacgctgttctgaaggaatct
gccacatttcaatgtgtcgtggctggttcccagccactaacggtatcttggataaaagat
gagagaatccttgaaaatgatgagaacttccatattacatttgagcaaaatattgcaaaa
ctgaaggtcaagaaagttgaccttagtcacagtgggagatacacctgccaggcaaagaat
gaggcaggagttgaaaagtgctttgctttactgttagcacaagaacctgctcagatcata
gaaaaggcaaaaacagttaaagtgactgaaagagacccagtcaccctggaatgtactgtg
tcaggaaccccagaacttcaagtcaaatggtttaaggatggaaaacaacttatgcccagt
agattttacaccatgagccttgacaataatgtggccagtttcaggatggaatccgtagtg
aaggaagacagtggtgtctatacttttaaagttgaaaatgattatggaagccaaacttgt
gaggccgttgtgactgtactagatcaagcaattccaccctcatttaccaaaaaattatca
aaaatgagtaaaattctcggatcatctattcatatggaatgcaaagtttctggatcactt
ccaattacagcaaagtggtatacagatggaaaagagatatctgacagtgcaaaatacaga
agtttgtgccatgagaacaccgtattgctagagattaataatctagagttgactgattcc
gcaaattacacttgcagtgtgactaacattgcaggaagcgactcgtgtagtgccatctta
gcagtgaaagaaccaccaagtttcctggcaaaaccagagagccaagaagcagttcctgac
tccaccgtggaatttaaagctgttttaaagggcacaccaccttttaaaataaagtggttt
aaagaagacttagaacttgcacctggacctaactgtgcatttggcattgaagggtcagct
ggtttcttaaatctttattcagtggacggcttaagaagtgggaattatacttgccaagta
tccaacgacgttggcagcgattcttgtacaaccacactgattataacagaacctccaaag
tttgctaagaggctcgacccactcagcgtcgtgaaacacggtgacttcacgcgatttgag
tgtaaagtcactggttctcccgaaatcagagtggtatggtacagaaatgatactgagctc
catgctagtgaaaatgtccacatgtcattcgtggattctatcgcagttctcgaaatgagg
catcttggcatcgaagatagcggagattacatatgtgaagcacagaatcctgctggcagg
gcaagctgcagtacaaagcttctagtaaaagaacctcccgtatttagcagaaaaccatct
ccggtagatacgctcaaaggtactgaagttcgcctggagtgtgaaatctctgggactcca
ccatttgatatcacatggtataaggacaagaggcaaatccgcagcagtaaaaaatacaag
gtcacatccaaaaactatcttgcaaatgtccatattcttaatgttgaaacctccgacatt
ggtgaatatcagtgcaaagctaagaatgacgtgggaagtgacacttgcatttgtactgta
aagctgaaagagccaccaaaatttgtcaccaaaataaacagtctgactgttgtggtgggt
gaaccagtagagttacaagcaacagtagaaggctctcagcctatttcagtcatatggctc
aaggacaaggaagatgtcatccgagaaagtgaaaacactgcaataacctacctggacaac
attgccactttacagcttgccaaagcagagctgtcaagcgctgggaagtatatctgtcaa
gtcagcaatgatgctggaacccgtgaatgtatggctactctaacaatcttagagcctgct
gtcattgtagaaaaggctgagccaatgaacgtcaccgtaggagatgtctgcaccttacag
tgcaaagtgagcggaacccctgagctttcagtcggctggtttaaggacgggaaagaacta
ataagcagcgacaaatacagaattgtcttctacaaaaacacgtctacacttaaaattctt
gattcagaaagtgaagacagtggcttatatacctttgaggtgcagaacaacgtgggcaaa
agtagctgcactgcgtcagttgatgttctagatcggatcattccaccctcttttacccga
aaactaaaagaaagccatggtgtgctggcttcttctgtgcttcttgaatgcaaagttgca
ggatctctaccaattactgttgcttggtttcataatggtcagaagctcactagtggtgaa
aaacatcagatcaccttttctgacaacgtttgctctttgcaaatcgcttccctgaaccta
tctgacacaggggcctacatatgcaaagctgctaatgtagcaggctccaatgagaccagg
gctgttttaactgtgcaagaaccaccctcttttgcgaaggaaccagaatctgtgcacatt
ttgccaggcagaagtgctacattttcagctaccatcaaaggaactccaccatttaaagtg
aattggtttagaggagtcaatgagctggtaccaagtgataaatgtaacatctgtttggaa
gactctgtcacagatctagaactatatgatgtggaaccatcacagagtggagagtacact
tgtattgtaagcaatgaagctggcaaagcatcttgcacaacacatcttttggtaaaagag
ccagcagtttttgtgaagaaactaagtgaccactgtgtggaaccaggaaaatctataatt
ttagagagcaggtacaccggcagcctcccaatttcagtcacatggatgaagaatggagtc
attttaagccaatctgataagtgtagcatcaccacaaccgaaaaatcttgcattctggaa
atacttaatactacaaaggatgaccaaggggaatatacctgtatggtggaaaatgaggct
ggagaagatatttgtgaagcattggtatctactttagaacctccttctttcattacacac
ttgggacctcttgaagtatcagttggagattatacaactttacattgtcaagtttctgga
actccagaaatcacaatatcttggtacaaaggagatactatattaagatccactcctgag
cacaagatgtatttcaaagacaacgtagccacattgatattcaacaaagtagatatcagt
gacagcggggaatatatttgcaaagctgaaaacagtgtcggatctgcctcttcaaatgct
atcttgacagttcaagaacgaaaacgtccaccttcttttgtgaggcaattaaaggatacg
gagcaaactattggcttcccagttaaatttgtatgccggctcaatgggtctgaacctatt
agtgtcacttggtataaagatggtgtacctttaagagacgacttcaacgtacaaacttct
tacattgataatgtggcaacccttcatctcttgcaaactgatatggcccattctgggcag
tattcttgcacagctactaatcctgttggaactgttacttctaacgctaggttcacaatt
tcagaaaccaaacaagctcccttgtttgatatcacacctgaatccagagatgttcctgtg
ggaaaaggtgttgactttgaatgtcatgtgactggaacccaccctatacatgctatctgg
gcaaaagatggccgagagatccgcacaggaggaaattatgcaattacatttgtagaaaac
acagctcgcttaaggattatgagagcaggcaaaggagattctggacagtatacctgccag
gctagcaatgtagttggcaaagacttttgctcagctcagcttaatgtgaaagaacctcct
aaatgtgtaaaaaagcttgaagcttcaagaatggtgaagcagggtgactcatgtcagctt
gactgtaaagtcagtggttccccagaaatcaaaattgcatggtataagaatgaccaagaa
ctccatgctagcgaaaaataccatatgaccttcagtgatgctacagcagtcctcgtcatt
gttgacgccaaccttgaagacagtggtgattacatctgcgaagctcttaattctgctggc
actgtgagctgcagtacagtagtcacagtaaaagagcctcctgtttttagcaagaaacct
agccctgtagacacccttaagggcactgatgctatccttcagtgcgaacttacaggcaca
ccaccgtttgaagttgcctggttcaaagacagaaagcagattagaggcagtaagaagttc
aaaattacaacgaagaacttcagtgccagtgttcatgtgctcaaccttgaagctgctgac
ataggagaatatcagtgcaaagcctccaatgaggtgggaagtgacatttgcacttgtact
gtcaagttcaaagaaccaccaaggtttgttaagaaactgagtgacaccttcacctacaca
ggggaacccactgctttacgagctgtagtggaaggttcccagcccatttccatcttgtgg
ctgaaggacaaaggggaaatgatcagagagagtgaaaatctccagatttcattttcagac
aacattgcaactcttcagattgcaagtgctgaaactgccagtggtgggaaatacatctgc
cagattaaaaatgatgctgggatgcgagaatgtgctggatacttgaaagttctagaacca
gctgtgatcttagaaaagtctgaaccaatgatagctacagctggcagtgcttttactttg
gagtgcaccgtaggtgggactccagagctaatcaccaaatggtttaaggatggaagacag
ctggccaacagccgcaaacaccagattatcttttccaataaagtagcaacacttaaagtc
ctttctgcagacatggatgaccgagggctttacacttttgaagtgcaaaatgaagtcgga
aaaagcagctgcacttcctccgtagatgtttcagaacaccttatccgaccttctttcata
agaagattgaaagaaacatttggtgtgctgggttcttccattgttctggagtgcaaagtt
gctggatcgctacctatgactgtggcttggttttatggaagcgatgagattttcagtggg
gataaatatgaaaccagcttttcagataatgtctgtatcttgaaggtgaatgctctagat
atctctgacacaggtccttatacctgtactgctgccaacgtagctggttctgatgaatgc
agtgcctttttgacagtacaagaaccaccctcttttgcaaagacaccggatccgctggag
gttttaccagggaagagtgtgacattcaggagtctgatcagaggaactcctccattcaaa
atgaactggttcaaaggaagcagggaacttgtgccggggaaaacatgcaacatcctcttg
acagattcaactgcagaactggaattgttcgaagtaggacctctccagactggagattac
acttgtcttgttactaatgatgctggcagttgttcatgtactacgcatctgtttgtgaaa
gaaccggctgtgtttgtgaagaaactgagcgatttcagtgtggagcatgggaactccatt
attctagaaagtagattcggtggaacccctccacttctggtgacatggaagaagaatggc
tcgaaactcacacagtctccaaaatgtaatataacgacaacagaaaaatcaggcatcctg
gaaatccttagtagtagcagagaagatgaaggagaatacacatgtgaagttgcaaatgat
gctggggaggatgtatgccatgccttggtatcaatcttagagccaccttactttattaaa
gacttggaaagagtggaggtgaccatcggagagcctttgtctttacgatgccaagtagct
ggaactccagaaatcaaagtctcatggtacaagggagataccaaactaagatctactcag
gcttataaaatgcacttcaagaacaatatagcaacacttacttttagccaagtggataat
gctgacattggcgaatatgtctgcaaaatagagaacagcgctgggtttgctacttcaaca
gctgtgctagctgtcaaagaccgtaaacttccaccttcgtttacaaagaagctaaaagat
gtacaagaaatgattgggtctcctgttgcttttgattgccgtatcattggctctgaacct
cttcaggtgtcttggtataaggagggggtgctcttgcgggacgatcataacattcaagca
accttcttaaataatgtagcaactcttcagatcttacaaacagagatggcacactctggc
caatacacttgcacagctcaaaatgctcttggaacagcttcctccagtgccaagctccag
ctctcagaacatctgataccaccttcctttgacgtgaagcctttgccagttgaagttgct
cttgggggaagtggttctttcaagtgtcacatcacaggttctatgccaatgaaaatcacc
tgggcaaaagacaaccgagacatccgtcctggtgataattacaagattacattggtagaa
aacacagccacactgactgttcttaaagtaggtaaaggtgatgctggactttatacctgc
tcggcaagcaacagtgctgggaaggatacttgtggtgctcagctgagcttcaaagagcca
ccaagatttatcaggaagttagattcctccagagttgtgaaagaacatgattcaactaga
tatgaatgcaaaatagctggatcaccagaaattcacattgcatggtacaagggcgaaact
caaattcaccccagtgacaaatacagcatgtccttcattgattctgtggctgtcattgaa
atgcacaatctgactgttgaagacagtggagactacgcttgtgaagctcaaaacccagct
ggtagtgctagcagcactgcatccctaaaagtgaaagctcctccagttttccgcaagaca
cctcagccaacagaatctttgaaaggagttgatgttcatcttgaatgtatgcttcaaggt
acaccgcccttccaaatttcatggtataaggataaaagagaaatccgaactagcaagaag
tacaagatgttgtctgagaattatgttgctagtctacatattcttaacactgatgatgca
gacgctggcgaatatcattgcaaagccgtcaacgatgtgggaagcgaggcttgcatttgt
tctgtgatgctgaaagtaccaccaaggtttgtgaagaaacttcacgatgtcagtgcaatc
gttggggagccagcagaattgcaagccacgattgaaggttctgagccaatttctgttctt
tggttgaaagacaaaggagaaattatccacgaaagtgacaacctctggatgtcatataca
gataaagtagcaatccttcaagttgtgcatgcagagccaacctacatgggaaaatacacc
tgtcagattaaaaatgatgctggaagccaggaatgctttgctaccttatcagttcttgag
ccagcaactattacagagaaaccagaaccaatgacagtcacaacaggagattcttgcacc
ttagagtgcactgtttctggaacacctgagcttactactagatggttcaaaaatggatat
gaactcacttctgaccagaaatacaaaatcactttcttcaataaagtatctgtgctcaag
attctgaatgcaggtttacaagatagtggagaatatacatttgaggtgaaaaacagtgtt
ggtcaaagccgttgtacagcttctatacatgtttcagatcgtattataccaccttcattc
acaaaaaggctgaaagaaacacaaggtctcttgggctcatcaagtgtacttgaatgcaaa
gtcattggatcccctccaatctctgttttttggttccgtgatggtgaggagatcactagt
ggagaaaaatatcaggcaacccttacagataatacatgttctttaaaagtgaatgctctt
caagagtcagatattggaagttacacttgtatagcaaccaatgaagctggaactgatgag
tgtgaagcatatttcatagttagagaacctccatcttttgtgaagaaacccgaacctttg
caggttttatctggggcaaatgtaacatttacaagtatcattaaaggaaccctccctctc
gatgtcaaatggtttaggggaagtgttgaactggttccaggacatagatgcaacgtatct
ctagaagaatcagttgctgaactggagctgtttgatgttcatcctgtccaaagtggagac
tatacttgcattgtcagtaatgaagctggcaaaatctcttgtacaactcatttctttgta
aaagaatcagcgaaatttgtgaagaaactgaatgacttccatgttgagaaaggaaaacaa
ttaattttagaatgctcatacactggtacccctcctattcaagtgtcttggaggaaaaat
ggtataaatttaactcagtcagagaaatgcagtattaccacaacagaaacatctgccata
ctggaagtctctaacagcagactagaagatgctggcctgtattcttgtcacatagaaaat
gaatcaggccaagataactctcaggcagctgtctcaatcttagaaccaccatactttgtc
caaaatctagagtctgtgcaagtgacagttggagattctgcatcattacaatgtcaaatt
gccggaacaccagaaatcaacgtgtcatggtacaaaggagacacaaaactaagacccacc
agtacttctaaaatgcactataaaaaccaagtggccactttggtattcagccaggtggtc
agcaatgatagtggggaatatatctgcaaggtagaaaatagtgttggggaagctgtatct
tcagcactgctatctgttcaagaacgtaaacttcctccttcattttcacgaaaattaaga
gacatccatgaaactgttggcttaccgactacatttgattgtggcattaatggttctgaa
ccaattgaagtaacctggtataaagatggtgcacaaataagagatggctacaatgtgcaa
atatcatatttaaataaagtcgcagttctacagatttcacaaaccgatatgagtcttgct
ggacaatatacttgcacagcttccaatgccattggaactgcttcttgtagtgccaaactc
atccttacagaggggaagatgccaccattttttgacatcccaattacgcctgttgatgca
gttgttggtgacagtgctgattttgagtgtcgtgtttctggaacgcgccctattaagatt
gcttggtcaaaggataaccgcgaattgcgaactggagggaattatcagatcagctataca
gaaaatatagcccatttgacaattctgaaagttgacaaaggagactctggaaaatattca
tgtcatgctagtaatgaagttggaaaagaatcttgcacagctcaacttaatattaaagag
cgacagaatccacctactttcaccaagaagttgtctgaaacagtagaagaagcggaagga
aacagctttaaacttgagggccgtgtttctggtacccaacctctgatggttgcttggtac
aaaaataaccaggaaatctatggaagccctaaatgtgaactagcctttgagaacaatact
attctgctgctcattaaaaatgcagaaccagccgatgcaggcttatatacctgcaaagta
tccaatgaagctggcagcgccctgtgtacttcctctgttgttattaaagaacctaaaaag
cctccagcatttgatcgacctcttaaaccagtgacaatagatgagggcaagatcctgcaa
ctggcctgccatgtagttggatcacagcccataaagatccagtggctcaaagctgggaga
gagctcagattgtctgataagtgcaacttcagctttgcaaacggaacggctctcttagaa
atccaagccgttactaaaactgattctgccgaatatgtgtgcaaagcctcaaacgcagct
ggaagtgattcttctaagtcaaaagtgacaattaaagaaaaacctgcagctgcaccagtt
gctaagaaagcacctactgatgccaggctttattttgtctctgaacctcagagtatcaca
ataattgaaaagagcttagcaacttttactgctaaagtcggtggtgatccgatccccaat
gtgaaatggatgaaaggaaagtggaggcaactcaatcaaggaggccgcattataatccag
caaaaaggagatgaggccaagctggaaatcaaagatgcaacaaaaactgattccgggcag
tatagatgtgtggcttttaatgagcatggtgaaattgaaagtgttgtcaaccttcaggtt
gaggaacggaagaaacaagttattgaaggtgatctaagagcaaaactgaagaaaactcca
acaaaaaagaaggaaggtgaggaagagcaggcaattgatatcatggaactcctaaaaaat
gtagatcctaaagaatatgaaaaatatgcccgcatgtatggaatcacagatttccgaggt
ctcctacaagcatttgagatgctaaaagaaagccaggcagaagaaacacacagactggaa
attgaagtaaaagagagatcaaggagagaagaacaagagtttgatgaacttgtagcattc
attcagcaaaggcttacccagacagagcctgttactttgatcagagatattgaagatcag
actgtgttgacagaggaagatgctgtctttgaatgtgagattaaaataaactatcctgaa
atcagactaacctggtacaaaggcacagagagattgatctcaaacaagaagtatgaaatc
aaaattgatggagaccggcatattcttaaaatcagggattgtcaacttggagatcaagca
aattatagggtggtctgcggtccacatattgccagcgctaagcttcatgtgattgaacct
gccgttgaacgtcatctgcgtgacacttccctcaaagaaggctttacctgctctttggtt
tgtcaattctctgtgccaaatgcaaaatctcagtggtacagaaacggaaaggtccttcag
ataggaggcagatattccaccgatgtctctgataaagtgcacagactcattatcaaagat
gtaagaacagaagaccagggacaatacacctgtaggtttgaccatctagaaacaactgct
gacctaataattgaagctgaaccaattcagtttacaaagaccatccaaaatattgtggtc
agcgaacaccagtctgcaacctttgagtgcgaagtctcctttgacaatgcaatcgtcacg
tggtacaaagggcccgtggaactcaaggagagtccgaagtacagctttagaagcgaaggt
cgatgccattacatgactatccacaatgttacctcagatgatgaaggtgtgtattcagtt
attgcttgccttgaaccaagaggtgaagcaagaagcactgctgaactctacctcaccact
aaagaaattaagctagaaataaagcggccagatgttccagatgctagagttgcagttcca
attgaagttccagctgaagatgttcctgttcttcctatcttaattcccatgccagaagag
aagaagaaaaaagaaaaagtggttagaaagaaaatactcaaaaaggtgactccaaaagtc
ccagaggaagttccacctcctaaagaaccagtcaagaaaccagaaccagaacctccatct
gctccagtcccagtccctgtcccagtctcagtcccagcccccaaagcagaagaagttatt
ctaaccaaagttccagccaagaaacgtgaagaggtcaaagtgacaactgtgattacgaaa
aaggagcctgcttttgagaaaagggaagagatccatgaggttcgcaaagaaacatatgaa
gaatgggaagaggggtatggggagaaacatgaatattatgaaaaagaagaaggttatgat
gaaggggaagaagaatggacatatgaagaaagaaaagagaaaaaaccagcttatcaggaa
gaatgggaagaggagtatggggaacaacatgaatactatgaacgaaaagaaggttatgac
gaaggcgaagatgaatgggcatatacagaaaaacaagtaaccctcaagaaaaagccagtt
tatcatgaagaagtggtccaagtccctaaaaagccagagcctgtgccaaaacgtccagaa
atttcagccaagaaagaagaaaagaaaaaaattacgatacaaaaagttactcggaagcct
gtaactgaagaagtagcaaaaaccgctcagcagttggaggaagaacaactgagaagagtt
aaagctccagaggttccatccaaaaaacctacaaagatggttattcatgaggaagttata
gaacgaaaagtcccagctgaacagaaatggactgtttcagaggaaaaagtgacagtatca
tatcacgaagaagaatatacatatggttcagaaccagaagagtacgagcgtgaagagttc
tatgtggaatatccaactgaagaaccagaagagtatgaagaagaaagggtctatgtagag
gttcctgaagttttaccaactaaaggggtccctaagaaaccagaagaaaaagtccctgtg
actgttctcaagaaaatagagcctccaccagctaaagttcctgaggtgcccaagaagcca
gtccctgaaaagaaaaaacctcctcctcctcctgaaaaagtggaggctcctccagctaaa
gttcctgaggtacctaagaaacctgttccagaaaaaagaaagcctgctgcggtccccaag
aaagaagtaccgccaccagctaaagtgcctgaagtgccaaagccagtaccagaagaaaaa
gtacctgttcctattcctaaaaaagtggaaccacctgctaaagtgccagaggtacctaag
aaagttattccagaagaaaaagttgccgttccgaagaaaaaagaggttcctcctgctaaa
gtacctgaggagcccaagaaagcaattcctgaggaaaaagtacctcggctccgtaaaaaa
gaagttccttcagcaaaagtgcctgaggtgccgaaagaagtaattgttgaggaaaaaata
acagttgctgtgcccaaaagagttgaaccccctccagctaaagtgcctgggatgcctaag
agggctgttgtagaagagaaaaggtttgtttctgaagaaacagtgtctgttactatttct
aaaagaatggaagctcctttacctaaagtggagaaatgggaagaagaagtagaggaagaa
gaagtagaagtagtagtagaagaagaagaagaagaagaacttcctatttctcgttggagg
gaagaagaagtctcttacgaggaagaggaggaaatttcagaagtaacagaggaggcctac
tatgcagaggaggaagtccatattactgttcccgaagaagtgccaccagctaaagtgcca
gaggtccggaagagacccgaaccagcaaagaaagaaccagttgttccccccaagaaagtg
gaagcccctccggcaagagtgcccaagaaagtccctcctgaagagaaagttccacctaaa
gttaaagaacccccaccagccaaagtgacagaaatccgcaagaaaaaagtggtcactgag
gaaaagatttctgtctctaaaaaggaagaagccccaccaaagaaagttgtgccaaagaaa
gtcgttccagaagaggaagtccgtgttccaatacctaagaaagtggtagcaccaccacca
cctaaagaagtgccagaacttccaaagcgacttgtatcagaagaaaaagtatctatggtt
atccccaaaagaaaagtagctccaccagaaaaagccatagaagaacgctggggttatgca
gaggaagtctctatttctgttcatacaggggaggaagtttcatatacagttcctgaagag
cctgagagagctatcagaaaagaaaaaatgcctatatcaattactacaaaaatgaagaaa
cctcccgctaaagttcctgaagttcgtaagactgttattaaaaaagaagtggtccatgtg
acagttcctccatatgaagaagaggctcctgaatatgaagaagaagaagttccccaatat
gaagaggaagaagtcccacaatatgaagaagaggaacgatatgaagaggaagtctcacga
tatgaagaggaagtctcacgatctgaggaggaagtctcacgatatgaggaggaagtatca
cgatatgaagaagaggtaactcatgaggaagaagaagtagtagtagtacctcattatgaa
gaggttcctgaatatgaagaagaggaagaaattcctccacctcctccacataaagtgcct
gaagtcgccaagaagcctgtgcctgagaaaaagaaacctgttcctgttcccaagaaaaag
gaagctcctccagccaaagtgcctgaagtgccaaagaagcctgtccctgaagaaaaggtt
cctgtgcccaaaaggaaagaagctccaccagctaaagtgcccaagaaaccggtacctaaa
gaggaagtgcctgttcctgtccctaaacgagtagaagcacctcctgttaaagtgccagag
attcctgaggaagcagaaattgaagctgaagtgcctctaccagctaaagtgccagaagta
cctaagaaagttgtaccagcaaagaagattcctgaacctgttcccaaaaaagtggagcca
ccagcaccacctgttgcaaaagttcccaaagctgtcccagaagaagaagtgcccgttccc
aaaaaagtgccagctccaccagccaaagtgcctgaagttcccaaacctgtccctgaagag
aaagtgcctgttcccaaaaaagtgccacctccaccagccaaagttcccaaagctgtccca
gaagaggaagtgcccgttcccaaaaaagtgccagctccaccagccaaagttcccaaacca
gtcccagaagaaaaggtccctgttcccaaaaaagtgccacctccgccagctaaaggtatg
ccaaattgttacttgtcatctgtgttattagacatgaactttggtacttcaaagtctgtg
atgtcttatatatgtgcacctgttgagaccaacatctttataaaaatcttccatattatc
ttaaaagtgcctgaagttcccaaacctgtcccagaagaagaagtgcctattcccaaaagg
gtgccagctccaccagccaaagtgcctgaagttcccaaaccagtcccagaagagaaagtg
cctgttcccaaaaaagtgccacctccaccagctaaagtgcctgaagttcccacacctgtc
ccagaagaagaagtgcctatccccaaaaaagttccagcaccaccagccaaagtgcctaaa
gttcccaaacctgtcccagaagaggaagttccagttcccaaaaaagtgccagctccacca
gccaaagtgcctgaagtgcccaaacctgtcccagaagagaaactgcctgttccgaaaaag
gtgccagctcctcccgctaaaggtacaggtgaaatttgtaacacagtgaaaacaaagttc
acaatacatttcataatgattcttctgttaagggttaaatgcccagatttgcctgaagtt
cccataccagtcgtagaagaagaagaagaagaagaagaagaagaagaagaagtgcctgtt
cctaaaaaagtaccagctccaccagccaaagttcccaaacgtgttccagaagagaaagtg
cctgttgctaaaaaagtgccagctccaccagctaaagttcaagtccccgaagttcccaaa
gtggtggaggaagaggaaatatttgaagttcccaaaaaagtgccagctccaccagccaaa
gtgcctgaagttcccaaacctgtcccagaagagaaagttcctgttcccaaaaaagtgcca
gctccaccagccaaagtgcctgaagttcccaaacctgtcccagaagagaaagtgcctgtt
cctaaaaaagtgccacctccaccagccaaaggtacatctaacatttataatagtaagagg
aaaacattaagattaaaatttcttatcatccatattgttcagttgcctgaagttcccaaa
cctgtccccgaagagaaagtgcctgttcccaaaaaagtgccacctccaccagccaaagtt
cccaaacctgttccggaagagaaagtgcccgttcccaaaaaagtgccagctccaccagcc
aaagtgcctggagttcctaaacctgttccagaagagaaagtgcctgaagctccccctaaa
gtgccagttcctccagccaaagttcctgtgataagaaagaagattgtccataaggaaaag
gtcaccgctcctgttcctactgctgaagaatatgtttacgaagaatatgagaagtatgaa
acatacgaggaggctggggtatacttgccagcagaagaagctgaagagttagaagaatat
gcagaagtgcaagaagaacctgaagttgaatattatgaggaagtttcagaagagcgtgaa
gttgagcattatgaggaagctccagaagaacctgaagctgaagagtataaggaaacagtg
gaagcagaggaatatgagtattatgaagaagttcaagtgattaaggagacagaagaatat
gaggaagtgtatgaggttccaccagccatagagcctgaagttcggaagccagtcccaaaa
gaaaaagtaccaactgctgttcctaaaaaagaagtggcacctccacctaaagttcctgag
atgcccaagaaagttatgctggaggagaaagtaattgttgctgtgcctaaaaaaccagag
ccaccatctcctgctaaagtgcctgaagtgcctaagaaagcagtcccagaagagaaggta
ccagctgctgttccagaagcacctccagccaaagtgcccgaagtacgaaagaaacccatt
ccagaagaaatacttgtgcctaaaaagccagaggcaccgccagctaaagtgcccgaggtg
ccgaagaaacccgttcccaaagaaaaagttccagttgcagagcccaaggaaccagaagct
ccacctgctaaagtgcctgaagtgccgaaaaaggttgtccctgaaaagaaagtaccaacg
aaagtgcctaagaaaccagaagttccacccgccaaagttcctgagattccaaaggaagtg
gtccccgaagaggaattccaggttcctgagatcaaaaagccagagccacctcctgccaaa
gtgccagaggttcccaagaaagttgtcccagaaaaggaaccaattgaacctgaagctcca
cctgctaaagtgccagaagtgccaaagaaagttgtccctgaaaagaaagtaccagctaag
gtgcctaagaaaccagaagctccacccgccaaagtgcctgaggaagtagtccctgaagag
gaagtcccagttcctgagatcaaaaagccagagccacctcctgccaaagttccagaagtg
ccaaagaaaatcattccagaagaaaaagttcctgtgaaaaagccggaacctccagccccc
aaagtgccagaagtccccaagaaagttgttccagaaaagaaaccagctgtaccagaggct
ccaccttctaaagtgcctgaagtgcccaagaaaattatcccagaagaaaaagtacctaag
aaaccagaacctcctgccaaagtgcctgaagtacccgaaaaggtgattgtagaagaaaaa
gagccaactcctgtacttaaaaagccagtaattaaaaaaccagaagctccgcctgttaca
ggtacatctcccaattcttccaaaataggtcaaataaaatttgccaataaaaaagtaatt
cttgttttatctaaagaaccagagcattttgcagtgaccgaagagccagaaccagttgct
gtgactaaagaagtagaaactcttgttcatgtggaagaaattgaagtcactgttgttctt
gaagaacctaaacctgctatagtgcccaagaaaccaaaacctaccacagtgcctaagaaa
gccgaacctactgctgtgcctaaaaaaccaaaagccgtgcccaagaaacctgaacctcca
ccaactaaagaagtttatgaagaagagcgagaaatccatactgttattggatacagagaa
gagaaaattgtgactgttcaccaagatgtagaagccatcggtgcattagaagaacctgag
cacgcggctgtgtttgaagtaacagagtctgaagaatacattttggaagaacgggaggcc
attgtttcacctgcagagccagaacctgttgccgaacctgaggaaccagccattgtacca
gttgctctgcctaagaaaccagagccggctgtgcctaaaaaaccagttgtggcagtgccc
aaaaagcccaaagttactcccatacctaaaaaacctgaacctgtagaagtgcctaagaaa
ccaatattcaagattaaaaaaagagagcacccaccagaaattgtagaacataaagaagaa
aaagaaataccaacattcattgcacgtagagaagagaaacgtgtggctgtgtacaaagag
gaagctgaggccatcactgcatttgaagaacctgagcgggcttcagcttttgaattaaca
gagcctgaactatatgtccttgaagaaccagaggacattgtttcatatgaagaaccagaa
cttgttcctgaagaacccgaagtcacggccattcctgaagaacctgaggttgctcctgtt
cttgaagaacctgaggttgctcctgttcttgaagaacctgaggttgctcctgttcctgaa
gaacctcccgcagtacctaaaaaacctactgaggttcctaaaaaacccaaagtcgttcct
cttcctgaagaacctgctccagccattacaccgaagaagccaaagccagttgctgtgcct
aaaaaaccagaaccagctgtgcccaaaaaaccagaacctgcttttaagaagcccacactt
actcctgtacctaaaaaagcagaaccacctaagaaaaaagaacctgagtttaagaaacca
gaacttccaccagaaactgtggagcatgaagaagaacgagaggtacagacatttattggg
tacagagaaaggaaacgtatccctgtacaccaagaagtagaggccatcaccgcatttgaa
gaacctgaaatggtttcagcttatgaagtaacggagcctgaagtatatgtccttgaagtg
ccagaggaggaggagcccgagcctgtggttgtccccgaagaacttgaggttgctcctgtt
cctgaagaacctcctgcagtacctaaaaaacctactgaggttcctaaaaaacccaaagtc
gttcctcctcctgaagaacctgctccagccattacaccgaagaagccagtgggcgtgtct
aaaaaaccggaaccagctgtgcccaaaaaaccagaaccagctgtgcccaaaaaaccagaa
cctgcatttaagaagaccaaacttactcccgtgcctaagaaagtagaaccatctaagaag
ccagaacctgaatttaaaaaaccaaaacttcccccagaaaccttggaacctgaagaagaa
cgagaagtgaaaacattcattggatataaagaacggacccgtgtgtctgttcaccaagac
atagaggccatcactgcatttgaagaacctgaagctgtttcagcttatgaaccaacggaa
cctgaagtatatatccttgaagtgccagaagaggctgttccaacccctgaggaggcggag
cctgttgtccctgaagaacctgagatcactaaagaacctaaaatacctgaaccagttaaa
gtgcctcaagtgcctaagaaggcagtgccagaagaaaaagtgcccgttgctgtgcctaaa
gaaccagagcatccaccagaagaagaaccagaggttattgaggaaattgaagctgaagaa
cctgttcctatttcagaaaaagaagacataattccaacagaagaaccagagccagaaaag
aagatattcccaaaacccaaaccccgtgttcctatcccaccaaaagaggaagttgaggaa
aaggttcagcttaaagtacctggactgaaaccacggaaacagcttcctgagcgtcctgct
cctgcacctaaggaagaaattgttctgaaaagagtcacaaaagctgttcagaagcctgag
gaggaagaacctaaaccagcgaaaccgcctaaagttgaacccaagcccgttgaaaaaatt
aagaagcctgaagtgccagagattgaaaagaagaaaattgagattccaacgatcaagaaa
aaagaagaaatagaaaagccagtgcctgaaccagccaaagttccagaacctaaaccagca
atgattcctgaaccaaagcctgctgtagctctgaaatctcctaggccagctgtcgcacca
gcacttgacgttgcccctgtgatggccccagtggttgggaagatcgctgagcccaaaatt
acaccaaaggaggaagctgccaagggtagaagtcctattaaagccaaaaggacaccttca
ccccttgatgcagaaaggaggaaattaagaccaggaagtggcggagacaagccacctgaa
gagcctccgttcacataccaactgaaggctgttccactcaagtttgtgacagagattaaa
gatatcgtgctgacagaagcagagtccattggctcttcggccatctttgaatgcctcatc
tctccatctactgctatcacttcttggatgaaggatggcagcaacatccgggaaagcccc
aagcacagattcttgtctgatggcaaagaccgcaagctccatattattgacgttcagctt
tcagatgccggggagtacacctgtgtcctaaagttgggaaacaaagaaaagacatcaata
gctaaactcgttgttgaagaactaccagtgcgctttgtgaaacccctggaggaggaaatt
accgtcatcaaagggcagcccttttatttgagctgtgaactgaacaaagagagagatgta
gtatggagaaaggatgggaaaattgtctcagacaaatctgggaaatttgctctaggtatc
attggcctccagcgggccgttaccatcatggatgctgacgataacgatagtggagagtac
actgtaactgtggcagatagtgatctcagttgtaaaacaactgttaaagttgttgaaatg
ataaaggactggctagtgaagcccatccgagaccagcatgtgaaaccaaaaggcaccgct
acgttttcttgtgacgtggttaaagatacgccaaatattaggtggtacaaaggcgaagaa
gaaattcctcttgaacccaatgacaaaactgaaattgtaaaagatggctctcatatcttc
ctcaaaattaagaactgctctccagacgatgtcggggaatattcagttgaagttgaaggc
cgcagatatccagcaaaactgaccttaggtgatcgtgacgttgaactgctaaaacccctt
gaagatgttaccatttatgagaaagaaacagccaatttcgatacagagatttctgaagaa
gacatccccggggaatggaagctgaaaggagaaatcctccgaccatcccctacttgtgag
atcaaagctgaaggaggaaaacgcttcttaactttacataaagtcaaagtagatcaggct
ggagaagttctctatcaggctttgaatgcccttaccacagccatcctaacagtaaaagaa
attgagctggactttgctgtgcctttgaaagatgtgaccgtgccagagaaacggcaggca
aggtttgaatgtgtgctaaccagagaagccaatgtcatatggtccaaaggcactgacatc
atcaaaattggtgacaaatttgacataattgtagatggaaagaagcacattctggttatc
aatgattctcagtttgatgatgaaggagagtacactgctgaagttgaagggaagaagacc
acagcaagactgtttgtagaaggtattaggctgaaattcatcactcccctcaaagatcag
acagtgaaggaaggagagaccgcttactttgattttgaactttctcatgaaaagatgcct
gtaacctggtataaaaatgacaaaaaacttcataacagtagaacagttcatatctctgca
gaagggaagaatcacaaactggaaataagtgaagtgacactggatgatatctctgaaatc
aaagctgtagtaaagaacttgcacactcaagcacacctaaaagtcttagaggctgatcca
tatttcacggtgaaattgcaagactatactgccattgagaaagacgatgtcattttggaa
tgtgaacttagtaaagatgtgccagtgaagtggtacaaagatggtgaggaattggtagct
tccaagagaatctccataaagacggacggcaaacgtcgcatactgaaaattaagaaggtg
tcagatgctgataaaggaaattacgagtgtaattgtggaactgacaagacaaattgtgaa
ctcaaggttgagcctcgaatgataaacatagagcgtcctttatatggtgtggaggtattc
attggcgaaacagcacgatttgagattgaaatatctgagcctgatgttcctgcaatttgg
aagttaaagggagaaactttaacagcttcacctgattgtgaaatgattcaagatggcaag
aaacacatcctcattcttcacaactgcaaattggatatgaccggagaggtgtctttccag
gctgctaatgctaaaagtgctgccaatctaaaagtgaaagagcggcctctcctctttata
actcctctcagcgatgtcaaagtctttgaaaaggatgaagctaaatttgaatgcgaggtc
tctagggaaccaaagactttccgatggttgaaaggaacccaggaaatcccagaagatgtg
aagtttgaaatcaagtccgaaggcacgaggcacgctcttgtcattaagagcgtagctttt
gaagatgaagcaaaatacatgtttgaggccgaagacaaacgaacaagtgctaaactgatc
attgaaggcattcgtcttaaattcattaccccactcaaagatgtaacagccaaggagcgt
gaaagtgcagaattcactgttgagctttcccatgacaacattcctgtcatctggtataaa
aatgaccaacgactccatacatccaaggttgtttcgatgaaagatgatggcaaatttcat
acgctcacatttaaagatctaactattgatgacacatctcagatcagagtggaagctatg
gacaaatcaagtgaagctaaacttacagttcttgagggtgatccttactttactgggaag
cttcaagattacactgcagtggaaaaagatgaggttatcttacagtgtgaaattagcaaa
gcaaatgctccagtgaaatggtttaaagatggacaagaaataactccctccaagaatgtg
attattaaagctgatggcaaaaagagaatgcttattctgaagaaggcactgaaaaaagat
atcggtcaatatacctgtgactgtggcactgaccagacatctgccaaactcaacatagaa
gaccgtgatatatctattgtgcgtcctctatacagcgtggaaatatttgagacagagaca
gctcgttttgaaactgaaatttccgaggaagacattcatgcaaactggaaactgaaagga
gaatctttgactcagtcagctgattgtgagattaaggaagaaggcaaaaggcactgcgtt
gtactctacaatgtacgtttgaaccaggctggtggtgtagacttccaagcagccaatgtc
aaatcaagtgctcatcttcgagtaaaaccacgtatcattggcttggtgagaccacttaag
gacgttactgtgacggccggtgaaacggcaacctttgaatgtgaactctcctatgaggga
attgtagtggaatggctgctgaagggggagaaattggaacccagtgacaaggttgtgccc
cgtgctgatggaaaagttcatactcttgttctcagggatgtgaagctaacagatgctgga
gaagtcacactgactgcacaagacttcaaaactaaagcaaatctttttgtaaaagaacca
cccatagagtttactaaaccccttgaggaccaaactgtagaggaggaagccactgcagaa
ttggagtgtgaaatatccagagaaaatgcacctgtgaaatggttcaagaatggccaggaa
attcacaaaacaaagaaatacgatatcattgctgatggcagagtcagaaaacttattatt
cgtgactgcacattggatgatgctaaaacatacacctgtgatgctaaagatttcaaaact
tcttgtttcttgaatgttgaaccccttcgtgtcgagtttcttaaacctcttactgatctt
gaagttaaggaaaaggaagcggctcggtttgaatgtgaaatttcccggccctctgttaag
gcacagtggtttagggatggagtcgaaattaaaaaaggcaagaagtatgacatcattgca
aaaggtgcccagagaatacttgtcatcaacaaatgtttacttgacgatgaagcagaatat
gcttgtgaagcaaaagcagccagaacttcgggcatgcttacagtgatagaggaggaagct
gtctttactaaaaacctgcccaatgtggaagttaatgaaacagacaccatcaaatttatt
tgtgaagtctccaaacctggtgcagaagtaacatggttcaaaggagaccaggagttgcca
gagggtggcagagttgaacaaaaagttgatggccgaaagagaattttgatcattcacaat
gcttgcctagatgacgcgggagcctacagttgcaagcttccaaacgctcagactacaggc
aaactcaaagtcaatgagctttcagcagagtttataactaaacctcaaaacattgaagtt
attgaaggacaaaaggcagaattttcctgctcagtgtctaaagatggcgtggacgtgcag
tggctcagaggcgatactattcttgaagcaggcgacaaatatgatatattttctgatggc
aaaaagagagtcttggccattaaagaatccgtcttggatgatgagggacgttatactgtc
atgcttggagatgtcaaagcaaaagccctgttgaaagtgattgaaaaactcaggattgtt
attccgctgaaagaccaaactgttaaagaaggagaagagcttgtcttcaactgtgaagtt
aatacagaaggtgccaaagctaaatggtacaaaaataacgaaccgatatatgacagcgca
aaatacatcatggtccacaaggatttactgtattctctaaggatcagagatgctcatctg
aatgaccaggcagtttacacagtgacactaacaaatccgcgaggagaacatgtcaagtcc
tctgctaatttaactgtacttgaggaggatctcagaattgttgaacctcttcaagacatt
gaaaccatggagaagaaatctgtcaccttctggtgcaaagttaaccgtcttaatgtaaaa
cttccctggacaaagaatggcgaagaagttacttttgaccgtcgcattttatacaaagtg
gacagatacaagcattcccttattattaaagattgtgggtttatagatgaaggggaatac
actgtcactgccggccaagataaatctgttgcggagcttattatcacagaagcacctgcc
gatttcatcgaacatttgcaggaccaaaccgttactgaatttgatgatgctgtctttagt
tgccagctttccaaagacaaagcagctgtgaagtggtacagaaatgggcgtgaaataaaa
gaaggcaaaaagtatcagtttgaaaaggatggaaatctacacagattaattataaaagat
tgcagactagaagatgaatgtgaatattcctgtggagtggatgacaggaaatccagagca
agactcttcgtggaagaaattcctgttgagatcatccgcccaccagaagatatttatgaa
gctcctggtgctgatgtcatctttttggctgaactgaataaagataaagtggaggtcaaa
tggctgagaaacaacatgattattgtccaaggtgacaaacatcaaatgatgagtgaagga
aagatccacaggttgcaggtctgtgaaataaggccccgtgaccaaggagaatatagattt
attgccaaagataaagaagctcgagctaagttagaactagcagctgctccaagaataaag
acaggcgatcaagatcttgtggtagatgttggccagccattaaccatggtagttccatac
gatgcttatccacgagcagaggctgagtggcttaaagaagatgaagccttacccactcag
actgttgatactacagctgagagtacttctttcagaattcctgcagccaagccatcacac
aagggaagttacaaagttatactgaaaaataaacatggaaaagcagaaggtcgcattaac
gttcaagtaatcaatgtacctggcccggtgaggaacttggaagtcacagaaacatttgat
ggtgaagtcagccttgcatgggaagaaccagaaagcgacggtggtagtaagattacaggt
tatgtggtggaaaggcgtgacatcaaacgcaagacctggattttggcaactgatcgtgct
gacagttgtgaatacacagtaactggccttcaaaaaggcggagtggagtacctcttccgt
gtgagtgcgaaaaacagagtcggcactggtgaacctgtggtaacagataaacccgttgaa
gcaaagagcagatttgaggtgccgggtcctcctctcaatgtacaggtcgctgatgtgaac
aggtccagcgcaacccttacctgggaaccaccagaatatgatggaggatctccaattaca
ggctatgtcattgagctgcgtgaccgaggatcaattaagtgggagccagccatgactacg
ccagcccatgaattatctgccacattgacggatgttgtggagaacaaagaatactttttc
aggatcagagcacaaaaccaagttggagttggcaaacccagtgcatccacacatgcagtg
aagataacagatcccatcgaaagaccaagtcctcccattaaccttgatcattctgagcaa
actaagtcatccgtgaaactggcatgggagcgtccactaaaagatggaggtagtccaatt
ttgggctacataatagaacggcgggaagaaggaacagttgactggattcgctgcaatgca
aagctggcacctaagctttcttataccgtgactggattgacacctctagctaagtattat
tatagagtctctgcagaaaatgctgctggtatatcagatccagctgaggctattggacca
ctaaccgcagatgatgtacatgttggacctacaatggacttaagtggctttaaagatgga
cttgaagtgattgttccacagccagtcaaaatccgtgttcccatcactggctacccagtt
cccaaggccacatggtcagtgggtggcaaagttttagaagatagtgatcgagtgaaaatt
gagaccaatattgcctttgcaaaactgactattacgcctagcgaacggcgagataaaggc
atttattctttgaaattagtcaatcctgtatcgtctgtatcaggagaaatcgacgttaat
gtcattgcttgcccaagtgcaccaagagaactagcagttggagaaataaccaggaacaca
gtgcaactaacatgggaacctcctgaaaatgatggtggaagccctttgactggctatctt
atcgagaagcgtgaagtgagccgcaaaatatggattaaagtgattgacaagattcttgac
caagaatttattgtcccagatcttgcccaaggcaaagaatatttattcaaagtttcagct
tgcaacaaatgtggaccaggagagcctgcttacattgatgagccaattaacatgacatca
cctgctacggttcctgatccaccagagaatgttaaatggcgagatccaacatctaagtcc
attttccttacatgggacccacctaaatatgatggtggctcacgtatccaaggctaccta
gttgaaaagtgccagcgtggcactgacaaatgggagccttgtggtgaacctgtaactgag
accaaaatgaaggtggcaccacttaaggaaggggaatggtatgcttatcgggtgaaggct
ctgaataggcaaggagccagcaaaccaagccagcccacagatgaaatccaggcagtggac
gcaatggaggctccagagattttcttagatgtgaaattactggctggaatcactgtcaaa
gctggaactaaaatagagctgcctgcaagagtaactggaaagcctgaacctcggattacc
tggacaaaagcagaaactatcttgagacctgacaaaaggatctccattgaaaccaaacct
ggccattccacagtaataatattagacagcaaaagaagcgatagcggcacctatattatt
gaagctgtaaataccagtggacgggcaacagcaactgttgaagttaatgttctagataag
cctggtccaccagcggctttcgatgtgtctgaaataacaaacgtgtcttgccttttgaca
tggaatcctcctcgagatgatggcggatccaaaatcacaaactatgttctagagcaaaga
gctacagacagtgaaatatggcacaaattatcatccaccatcaaagaaacaaaattcaaa
gttacaaagctcacaccgcttaaagaatacatcttcagagtcagtgcagagaacatgtat
ggaattggagaaccagcactatcccatcctatcattgctaaatatccattcgatacacca
ggtcctccaacaggtgtaaagcctgttgagatcactaaagattctgttacattaacttgg
actgagccagatgaagatggcggcagtcctatcactgggtactgggttgaacggtttgac
cctgatcaagataaatggatacgatgcaataaaataccagttaaagatgcaacattcaag
gtaaagggtcttacaaaccataagaagtacaagttccgagtcttggcagagaatcttgct
ggaccaggaaaaccaagcaaacccacagagccaatcttagtgaaggatcccattgatcct
ccatggcctcctgggaaaccaacagtgaaggatgttgccaagacgacatgtttcctacag
tggacaaaaccagaacatgatggaggtgccaaaattgaatcctacgtggtggagctgtta
aagactggtacagatgaatgggtgagagtggccgaaggtgtccccatgacagaacatttc
ctcaaaggacttatggagaaacaagaatattctttccgagtaagagcggtgaacaaagct
ggggaaagcgaacccagtgaacccagtgatcctgtgttgtgcaaggaaaggctaaatccc
ccttcaccgccacgatggctcgaagtcattaatatcactaaaaacactgcagaccttaaa
tggaccgcgccagaaaaagacgggggttctcctattacaaactacattgttgaaaagagg
gatgtgcgccggaaaggctggcagactgtagataccacagtaaaagacaccaaatatact
gtgacacctctgactgaaggctctctctacgtattccgtgtggctgctgaaaatgcagtg
gggcagagcgattactgtgaaattgaggactcagttctagccaaagacactttcactacc
cctggagcaccatatgcccttacaccagttgaggtgacaaagagacacgttgacttaaaa
tgggaaccacctaagaatgacggtggcaggccaattcaaagatatgttattgaaaagaaa
gagaagcttggcacacgttgggtgaaagctggcaagacggctggacctgactgtcaattc
agagtaacagatgtcattgagggcacagaggtgcagttccaagttcgggctgaaaacgaa
gctggctgtggtcatcccagtgaaccaactgacatcctggctattgaagaccccacaagt
cctccttcaccacctctggatttgcacgtaacagatgcaagcagaaaacacattgccatc
gcatggaaaccacccgacaaaaatggtggaagtcctatcattggatacaatattgaactc
tgtgaagcaggaactgaaaagtggatgagaataaattctcggccggtcaaagacttgaaa
tacaaagcagaagaaggcattgtacccgacaaggaatatgtcctcagagtcagagctgtg
aatgctataggagctagtgaaccttcagacatttcagaaaacgttgtagccaaagatccc
gattgtaatccaactgttgatataaaaaccacagatattattgtggtggaaggtcaaaag
ttaagtgttccagttcccttcagagcggttccttctccaaccatttcatggcataaaagc
gggaaggagcttaaagcgggcgacagaaccaccatgaagagcgactacacctctgccttg
ctggaaatcacaaatgctgtccacgcagatgccggtgtttacaccattaccttggagaat
aaattgggttcaactactggcacagtgaatgtcaaagtaataggtctgcctggaccatgc
aaagatattaaggcaagtgaagtaactaaaagctcatgcaaaattacctgggaaccacca
gaatttgatggcaatactcccatattacactatgtgttggaaagaagagaagctgggagg
agaacatacataccggtgatgtctggtgaaaacaaattggcatggaatgtaaaggatctt
attccaaatgctgaatactatttccgtgttaaagctgtcaataaaattggaggaggtgaa
tacctcgaactgagaaatccagtgattgctgaggacccaaagcaacgaccagatccacct
cttgatcttgagactcataatccgacatcaaagtcagtaacgctcacgtggaaaccacca
ttgtatgatggaggaacgaaaattatgggttatgttttggaaaaactggtcaaaggagga
gataaatgggagagatgcaatgactatttagtgcctcttttgacttacactgtaaaagat
cttgaagaaggcaaagaatatcagttccgagcccgtgctgagaatgctgcaggagttagt
gaaccatctaatattactcctttaatcaaagcagtggatcctattgaggctccaaaggtc
tcccttagtgctaatttgcaggctggccttgaagtgaagcaaggtgctgatattccatta
gatgcacggatttcaggttcaccttacccagaaattgcttggttatggaacgatgaagtt
atccggtcggaagaaattaagaagagagtcgtcaaggtttccaggaagaagaaaggtgaa
gctgaagacgacgagcctttccggttatccttacctgagcggctaagcattgacaacagt
aaaaaaggagagtcttctctggttgttcgagactcactcagagcagaccatggcacattc
actatacgagttgaaaatgaccatggggtagctaaagcttcctgtgaagtcaatgtttta
gatgttcctggacctccggtcaactttattttcgaggaagttagaaaaaattccataact
tgcaaatgggatcctcctcttgatgacggtggtagtgaaatactgaattatgtcttggaa
aagaaagacagcgcaaaaactgaaactggctgggtcacagtcacttccacacttaggcat
tgcaaatataatgtgcttaaattgattgaaggaaaagaatacgtcttccgtgtgaaagcc
gaaaacagagtagggcctggaccaccagccctttcaaaacctgttgtagctaaagatcca
tttggtcctcctgatgcacctgacaaacctttagtagaggagcctaccagcagtagtatg
ttggttaaatggaatgaacctaaagacaacggcagccccattctgggatactggattgaa
aaacgtgaaatcaatggcactcattgggctcgggtgaataaagatcgtgtgaatgctctg
gaaacaagagttgaaggattgttggaaggattaacatacgttttcagagtttgtgctgaa
aatgcagctggtcctggcaaatttagccccccatcagatcctaaaattgcacaagaccca
atattaccacctggcccacctattccaagaatccttgatacaagttcaacatgtattgat
ctagcatgggaagctccactatacaatggaggtggagacatcactggttaccatgtttat
aagcaatttctgggttcaaatgaatggtcccgttgcaccgagaaacctgttaaggttcta
agctacctagttaaaggaattagagaaggtgctgattacaaacttcgagtgactgctctt
aatattgctggagaagggcctcctggagaaacagaacctataactgttgcagaacctaaa
gaacctcctactgtggaactagatgtttctgtcaaacaaggtgttcagatactggcaggt
caaacccttacactgcctgccactgtaactggacgtcctcatcctacaatagtgtggact
ttagaggagggggaaattgacaaggaccgagtggtgattgagaatgttggcacttcatca
gtattaagtatcaaaaatgcactcagaaaagaccatggaagatacgtcattactgcaact
aacgagagtggctccaaatttgctgcaaccagagcagaaatctttgatgttcctgggcca
gtaactgatctgcatcctgttgtggtgaacagaaaaatgtgtctgcttaactgggatgat
cccaaagacgatggaggaagtgagataataggcttcatcgtagagaggaaagatgccaaa
atgcatacttggagactcgctgtggatacagagagatcaaaatgtgatattactggtctt
gtagaagggcaagaatataaattccgtgtatctgccaagaacaagtttggctgtggtcca
ccagttgaacttgggccactacttgctgttgatcccaaaggccctccaactgcccctgag
aggttcatgtatacagagagaacaaaatcatcagttacccttgactggaaacctcctcgt
aatgatggaggcagccccatcattggctatcttgttgacaagagaagacatgactcaaat
gaatttgaaagagtcaataaaacaccttgccgagccacctcacttcttgtggataatctt
gctgaactgcatatgtatgaattccgagtcaaggcagtcaatgaaattggagaaagtgaa
ccttcactgcccctcaatgttgttatccaagacgatgaagaacctccgacagtgacattg
cgtctggccgttaggggagatactatcaaagtcatggcagggcaaccagtgaacattcct
gctgatgtgacgggtcttcccatgccaaagattgaatggtccaaaaatgaggttcccatt
gagaaaacatcagatgcccttaagatcaccaaaaaggaaatatctagaacagaggccaaa
actgaactcagtatgcctgcagtaactagaaatgataaaggcacttacacagttacagct
ttcaatcgtttgggcactgcattccgcaacgttcacgttgaagtatttgatcgtccttct
ccaccgagaaacctcgctgtttctgacattaaagctgaatcttgctgtttaacctgggat
gctccacttgataatggtggcagtgaaattactcactacattattgagaagcgtgatgca
agcaagaagaaagtagattgggaggaagtatccagcactgtggtagacagacgatttggg
gtctataaactgacaaccgatggtcactatcagtttagagttagggctgtaaaccggtat
ggaacaagtgatgaatgtctttcagagaaagtggtcatcaaggatccttatgggctacct
gggccacccggaaaaccaaaagtcatcgatcatactaggtcatcgatgcttgtaacatgg
acacctcctttggataatggtggggcaccaattactggctattggctagagaagaaagaa
gaaggaggtgtctattggtctcgcgttagcagagcacctgtaacaaaaccctcagtgaaa
ggattggacttcaatgtgttgcgtttgattgaaggagtaaagtatcagttcagggcgatg
gctattaacattgctggaattggtcctcccagtgaaccatcagatcttgttgaagctgca
gatccaatctttcctcctggtgcaccatcatgcccagatgtcaaagacagaactaagtca
accatatctctcgcatggaaacctccacaaaaagatggcggcagtcctattaaaggttat
attgttgaaatgcaagaagaaggtagtttggattggaagaatgtgaatgagccagacaag
ctgttccctacctgtgaatgtactgttcccaacctgaaagagctaagaaaatacagattt
agagtaaaggctgtaaatgctgcaggggaatcagagccaagtcttgctacttcagaaata
ccatgcaaggaaattctagaagagccagaaatatttattgatcttaaagcacaagatttg
ctttcttgtcgtactggctcagcaatcaaaatcccagcaattattaaaggacgcccagtt
cccaaagtaacttgggaatttgaaggagatgcaaagaaggcagtaaaggatggacataat
atacccgaagatgctacagtggaatcaactgataccagttcagtaattactattcctgag
tgtaacagaggtcattctggaaaatatagcattacagcaaaaaataaagcaggacaaaaa
actgtaaacgtgagggtgaatgttcttgatgttcctgggccaccaaaagacctgaaagta
agtgatataacaaggtgcaactgtaaactttcatggaaaatgccagacaatgatggtgga
gacagaatcagaaattatattatagagaagagaactgttgaagggaaagcctggaccaaa
gttaatccaaactgtgctggaacgtcattaattattcctgatctcatagctggacaacaa
tatttcttccgcgtacgtgcagaaaaccgctttggtgttggcccaccagcagatacaatt
caaagaactacagcacgagatcccatccaacctcctgatccaccaatcaagcttaagatt
ggtgttatcaccaagaactctgtcaacctgacttggaaacctccgaagaatgatggtggt
gctcctgtgacacattacaatatcgagtgccttcgttgggatcgtactggtcaaggcaag
gaggcctggcgtcagtgcaataaacgtgatgtggaagaaacaaagtttacagttgaggac
cttaatgaaggtgatgaatatgaattcagagtgaaagcagtaaatgaagcaggtcctagc
agaccatcagctacagttggacctattgttgtcaaagaccagacatgtcctccatcaatt
gaactcaatgagtttatggaggcagaagaaggaacagatattaacgttgtagctaaagtg
aagggtgtgcctttccctacgttgacttgggctaaagctcctccaaagaaaccagatgac
aaactaccagttgtatacgatcaacatgtcaataaagttgtgggtgaagactcttgcacg
ttggtgatacaacagtctcgcagaaaggatacaggcttgtacaccctaactgctgtcaat
aattttggaacagattcaaaggagatgagactaaatgttctaggtcgccctggaccacca
gaaggacccattaaatttgaatccatttcagctgatcagatgacattgtcttggctacct
ccaaaagatgacggtggctctaaaataacaaattatgttattgaaaaaagggaagcaaac
agaaagacatggatcaaggttaccaatgaacctaaggagtgcattttcacagttcccaag
ctggttgaaggccatgaatatatcttccgcattatggcacagaataaatatggcattgga
gagcctcttgatagtgaacctgaaacagcaaggaatcttttcactgttcctggaatttgt
gacaaaccaaccataagcagcgtcacacatgactccatgactgtcaactgggaggagcca
gaatatgatggaggctctcccgtgacaggttactggctggaacgcaaagaaaccactgga
aagagatggacaagagttaatcgtgatcctattaagcctatgacccttggcgtttctcac
aaagtaactggcctcattgaaggctcagattatcagttccgtgtatatgctattaatgct
gctggtgtgggtccaccaagcatgccttctgatccaatcactgcaagggatccaattgct
ccacctggccctccaattccaaaggtcaccgactggacaaaatcatcggttgatcttgag
tgggctccgccattaaaagacggtggctctaaagttactggttaccttgttgaattcaaa
gaggaagggaaggaagagtgggaaaaggcaaaagacagagaaataagaggaaccaagttt
gtcttggctggattaaaagaaggaggcttctacagatttagagtcagagcaatcaatgct
gctggtattggagagcctggagaagttactgaagttattgaaataaaggacagaatagta
cctcctgatcttcagctggatgcccacgtaaaagacagaattgttgttcatgctggtggg
gtcatccgcattatagcttatgtctcaggaaagccacctccaactattacttggagccag
gatgaaagacctctgccggaagaagctaaaattgaggaaactgctatcagttcttctatg
gtcataaagaactgcaagagaagtcagcagggtatctacaccctccttgctaaaaatgca
ggcggagaaagaaagaagactattattgttgatgtgctagatgtacctggccccgttgga
gtgccgttccttacggaaaacctaaccaatgactcttgcaaacttacgtggttttcccca
gaagacgatggaggttcagctattaccaactatgttattgaaaagcgggaagcagatcac
agagcttggacgccagtgtcttatacagtcaccagacaaaatgccactgtgcagggactg
attgagggcaaagcatacttcttccgcattgcaccggagaatatcattggcatggggccc
tttgtagagacgacaaaagaactcctaataagagatccaatcactgtgccggagaggcct
gaggatcttgaagtaaaagcagtaactaaggactctgttacactgacttggaacccacca
aagtataatggtggctctgacataaccatgtatgttttggaaagccgactcattggaaag
gataaatttactagaattacaaaagagaaaatgcttgatcggaaatacactgtggaagga
ctgaaagttccactgtgcatgctcatagcgcactcgcgaacgttgtaacaccctgttccg
tttggaagtaaaacgtctcctccccaacttgagcttgatatcagagaaaagctgacagtc
cgggtaggagaagcattcagtctgactggccgatattcaggcaagccaacaccgaagatt
acttggtacaaagatgacattacagtgaaagaagacaaacgaactatgatccagactact
ccggctacaatttgcttgggtatattaaaatctgtccgggaagattcaggcaaatatagc
gttgttgtagaaaacagttcaggatcaagaaaaggattctgtcaagttactgttgttgac
cgtcctacacctccagtggggcctgtcatttttgatgaagtacataaagaccactttgtt
atttcctggaaacctcccttggatgatggtggtagtccaattacaaattatattattgag
aagaaagatgctaacagagatctctggatgccagttacatccgcaagtgtcaaaacaaca
tgcaaagttcctaaattactggaaggaagagattatgttgtccgaatttatgctgaaaat
ctgtatggcataagtgatccactgatatctgatgaaatgaaggccaaggatcgttttagt
gttcctgatgcaccagagcagccaattgttaagaatgtcaccaaagattctgcattagtt
acctggaacagaccacgcgatggaggaaaaccaataactaattacatccttgaaaagaag
gaaacaatgtctactcgatggacaaaagttacacaagaacctatttatccagatacccaa
tttagggtacctgatctccttgaaggctgtgaatatgaattccgggttgcggcacaaaat
gaaattggcattggtgacccaagccccccgtcaaaaccaatctttgctaaagatccaatt
gttaagccaagtcctccaattaatccggaggcagtggataaaactaagaattcagtggat
ttgtcctggcaaccaccacgtcatgatggaggagggaagattataggctaccttattgaa
taccaaaaggttggagatgaggaatggaagaaagccaattatactgctgattcttgccct
gatacaaaatatagtgtaactggcctcactgaaggtactaaatataaattcagaatcatg
gcagttaatgcagcaggtgaatcagagccagcctatgtccgtgatccagtggaaatcaag
gacagacttgagcctccagaattaatcttggatgctaatatggcacgggaacagcatgtt
aaagttggaactacactgagactcagtgctgtaattaaaggaattccattcccaaaagtg
acttggaagaaagaagataaggaagtttctacgaaagcagatattgaagttacaaaagtt
ggtagcaaactggaaatacgtaatgctgcccatgaagacggaggaatttattccctgacg
gtggagaatcctctcggatcaaagactgtttcagtaaaagttgttgtgctagacaagcct
gggcctcctagggattttgaagtgagtgaagttagaaaagattcttgttacctaacttgg
aaggaacctgaggatgatggtggctccgtcattaccaactatgttgtggaaaggaaggat
gttgctgctgctcagtggttaccaatatcgtcctcttctaagaaacacagtctgttggct
aaataccttatggaaggcactcagtatctcttccgtgttgctgctgagaatcagtatgga
cgaggaccttttgttgaaactcacaagccaattaaggctatggatccacttcatccacct
ggaccaccaaagaacttgcatcatgtagatgttgacaagacagaagtctctcttgcttgg
aattggcctgatcgtgatggtggtgctgaaataactggatttttggtggaataccaagaa
gaaggaacagaggactggacgaaattcaagacagtccctgtgccagaatgtgttgttaca
ggcttacaacaaggaaagatttacaaattccgtgtgaaagcccaaaatattgtgggtctt
agtcttccagacacaactatacccattgagtgccaagaaaagatagtgccaccatctgtt
gagctagatgtgaaattaatagaagggcttgttgttaaagctggcagcacagtaagattc
cctgcaatcatgagaggagtgcctattcccactgcaaaatgggtcactgataatactgaa
atcaaatcagaaggcaattacaaaattgatactgacaactactcaacaattcttaccatt
aaaagttgtacaagaaaagatactggagaatatttactcacagtatccaatctagctgga
agcaaaactgtagctgttcatttaaccgtcttggatgttcctggtcctcctactggccca
attgatattgtagaagtagctccagatcacatggttattgcttggcggcctcctaaagat
gatggtggtagtcctgtaactaattatattgttgaaaagcgagagtcaaagaaagaaacc
tggggagtagtctgttcatcacttagtcaaacaagacttaaaattccacgcctacagaag
ggtgctgaatatatcttccgagttcgtgcagagaataagataggcattggtccacctctt
gattcccaaccagcagttgctaagtctatgtttgatccaccatctcctcctggtaaacca
acagttcatgatattactgaaaacgctgcaacagtaaattggactatgccaaagtctgat
ggaggaagtccaataactgggtatattcttgaacgtcgtgaaatttctggcaagtggata
cgagtaaataaatcaccagtacttgacctgaagttcagagctacaggcctttatgagggc
aacacatacgaattccgtgtttttgctgaaaatagtattggcctaagcaaaccatctcca
gtttcagacccaataaaagcaacacgtcctatctcacctcctgggcctccaattaatcca
aaactcaaagataagaccagagaaacagctgaactggtatggacaaaaccactcaaggat
ggtggtagtcctatactgggatatgtcgtagaatgcctgaaaagtggaacaactcaatgg
aatagaattaacaaagatgaacttattcgaccatgtgcctttacagtacctgggctaatt
gaaggaaatgaatatagattccgtatcaaagctgcaaatattgttggagaaggagaacct
agagaattgcctgaaacagttcttgctaaagacattctgactcctccagagctagaactg
gatgtgacctgccgtgatgtcattacagttagagtaggccaaacaataaagatcctaggc
aaagtgaaaggtagaccagaacctgacataacatggtcgaaagaaggcaaaatactgaca
aaagataagcgcactgacataattcaagaagttccacgcatagagctacaaattaaatca
gctacaagagcagaccatggcaagtacattattgcagctaaaaacagcagcggacatgcc
caagcatcagccattgttaatgtacttgacaggcctggaccttgtcgaaatctgaaagtc
agctatgtcactaaggattcctgtatgatcgcttttgagaatccagaagataatggtggc
tctgaaattacaaattatatagtagaatatcgccaaccaagtcagaaaggatggtcaata
gtctcttctgatcttactaagaggatggtaaaagcacatctcatagaaaatcatgagtac
ttcttccgtgtttgtgcagaaaataaagtaggtccaggcccagttgtcgagaccaagact
ccaatccttgccattaatccaattgataggccaggtgagcctgaaaatcttcatattgca
gaaacaggaaagacatttgtgcatctgaaatggagaaggccagactatgatggtggtagc
cccaatttatcttaccacgttgagcgaaaaccgaaggattcagatgaatgggaaagagta
cacaaaggcagcattaaggaaacacagtatatggttgacaaatgcgttgaaaataaaatt
tatcagttcagagttcagactaagaatgaaggaggagaaagtgattgggtaaaaacaagt
gaagttgttgttaaagaagaagtgcaaaagccagtacttgatctgaaattgtctggagta
ctcactgtgaaagctggtgaaccaattaaaattgaagcagggcttaaaggcaagccgcaa
ccagaagtatcttggtcaaaggatactgaagatttatccaaatctccaagggtcaaaatt
gaaacaacttcacattcatctaagttgcttcttgcaaaatcaagacgtactgatggtggt
aaatatgttataacagctactaatccagttggtagctttgtagcgtatgctactgtaaat
gttttggacaaaccaggaccagtaagaaatctcaaagtctctgatatttcaactgacaga
tgtaaagtcagctgggacccacccgaagatgatggtggttgtgaaatacagaattacatc
atagagaaatgtgaaagcaagcgtatggtttggaccacatattcctcttcagtgataatg
gactctgtacaagtaacacatctcatagaagggaatgaatatatctttagggttcgtgca
gaaaacaaaatgggcactggtccaccaacagagactaagccaattatagctaaaacgaaa
tatgatagacctggtcgtcctgatcctccagagatcacaagagttagcaaagatgagatg
actgtagtatggaatccaccagaatatgatggtggaaaatcaattacaggatatatatta
gagaagaaggagaagaggtcactaagatgggttcctgttaccaaaactgcaattccagaa
agacgcaagaaagttacagatctcattcctggatatgaataccaattccgtgtgaaggca
gaaaatgaaattggaattggtgaaccaagtttcccatcaaggcctgcagtagcaaaagac
ccattagaaccacctggtcctcccatcaatcttaaggttgttgatagcacaaaaatgtct
attacacttggctggggaaagccgctctatgatggtggagctccgattattggatatgtg
atagaaatgaggccaaaaaccgaaaaagctggtcccaatgaaggatggaaaagatgcaat
gttgcagcacaagtcattcacacagaatttactgtgatgagtctggatgagaaagaacta
tatgagttccgtgtttctgcccaaaatcaggttggcattggtcctccagctgatttgaag
gaagctgtttctccaaaagaaatacttgagcccccggagatagaattggatgctagcctg
aggaaattactcatagtcagagctggatgccccatcagactctttgctattgttagagga
cgaccagcacctaaagtcacctggaggagagtgggaattgataatgtgatcagaaagggc
caggttgacttggttgacacaatgtccttctgtgtcattcctaattcaactcgtgatgac
tcgggcaaatactctttgactcttgttaaccctgctggagaaaaagctgtgtttgtcaat
gtccgtgttcttgatactcctggacctgttgcagacttcaaggtctctgatgtcactaaa
atgtcatgtcagctttcatggacaccacctgagaatgatggcggtagtcctgtcacacac
tacattctggaaaagcgcgaggctgatagaaaaagctggggaactcttatttcagatata
aagaagactagtttcaaagttgctaaccttgtgcctggtactgaatacttcttcagagta
actgcagtcaatgaatatggtccaggtgttccaacagatacacctaagccaatcatggca
acagatccactaagtgaacctgatcctccaaggaaacttgaagtaactgaaattaccaaa
aacagtgctacattaggatggctgccaccactgcgtgatggtggtgccaaaattgatggg
tacattatttcgtatcaacaagaagggcaagcgggtgatcactggacacagtactctgtt
gtaaaagatcttaacattgttgttgctggcctaaaggaagggaagaaatataaatttaga
gtggctgcaagaaatgctgttggagtgagtttaccaagagaaacagaaggcatgtttgaa
gtcaaagaacaactcatgccacctaaaattctgatgccagatcatatcggtataaaagct
ggacagaaactcagaattgaggcacatgtttatgggaaaccttcgccaacctgtaaatgg
atgaaagcagaccaagatgtgcttacttcgagtcgcctggcagtgcataaagccgacggc
acttcagttcttattattaaagatgtaactagaaaagatagtgattattacagcctaaca
gcagaaaacagctccggagtagctactcagaaaatcaaagtcgtcgtcatggatatccct
ggaccacctcagccaccatttgaaatttctgatatagatgccgacgcctgtagtttgtct
tggcatatcccacttgaagatggcggaagtaacatcactaactatgtggttgagaagtgt
gatgtcagtcgcggtgattggataaccgcagtagcttctgtcacaaaaacaaattgcaga
cttggaaaactgacccctggtcaggaatatgtgttccgtgttcgtgcagaaaaccgattt
ggcatttctgagccacttcaatctgataagatggttgcaaggtttccatttgatgtcccc
agtgaacctaaaaatgcacgtgttaccaaagtaaacaaggattgcatttttgtagcatgg
gataggccagacagtgatggaggcagtccaataactggctatctcattgagcgtaaagaa
aggaacagtttgctgtgggtcaaggccaatgatacccctgtgcgatccacagaataccca
tgcgcaaacctaattgaagggctagaatacacatttagaatctatgctctgaacaaagca
ggcgcaagcaagcctagcaaaccaacagattatgtgactgcaagaacaccaattgatcca
cctggcaaacctgaagttattgatgtgacaaagagtactgtgtctcttgtctgggcaaga
ccaaaacatgatggtggcagcaagataattggatactatgttgaagcctgtaagctgcca
agtgctaaatgggtccgatgcaattctacgccccatcagatccctcaagaagagtacacg
gcaactgatttggaggaaaatgctcagtaccaattcagagcaatagcaaaaacagcagta
aacattagtgcaccttctgaaccttcagatccaataactgttcagtcagaaaatgtacca
cccaagatagagctcggggtaggtatgaaatccttacttgtagtaaaggctggaaccaat
gtttgcctggaagcaaatgtctatggcaaacctatgccaactattacttggaagaaagaa
ggggaggttctaaaaccagtggaaggaattaagatcaccaccaagagaaacctatctact
gtggagctcttcagtgtcattagaaagcagacaggagattatactattactgctgagaat
gcaagtggttccaagtcagcaactataaagcttaaagtgttagacaaacctggtcctcca
gcttcagtgaagattacaaatatgtatgcagatcgagccatgctctcttgggaacctcct
cttgaagatggagggtcagacattacaaattacattgttgacaaacgtgaaacgagtaga
cccaactgggctcaagtcactgccaacgtcccaatcactagttgcagtgttgagaagctg
attgaaggacatgagtaccaatttcgcatttctgctgagaacaaatacggagtaggtgat
ccaatcttaactgaaaatgcggtggctaaaaacccatatgatgtacccgggccttgtgat
ccaccaataattagtaacataacaaaggacttcatgactgtgagctggaaagcccctgct
gatgatggtggctcccctataactggatatattgttgagaaacgtgaaacaaaagctctt
aactggacaaaagtgaatagaaaaccagtcattgaaagaatgataaaggccactggactc
caagaaggaacagaatatgaatatagagtaattgccttcaataaagctggaccaggcaaa
cctagtggagcatctaaggcagcatatgctcgtgatcctcagtatcctcctgggccccca
gcattcccaaaagttgttgatactacacgtagctctatcagcctgtcttggagcaaaccg
gcatatgatggtggaagccccattattggctatcttgttgaagtgaaacgagttgacaca
gaaaactgggtccgatgcaatttgccaaagaatttgcctgatacacattatgtagtaact
ggacttacagagaacacagaatatcagttccgcatttatgctgtcaataaaattggctac
agtgacccaagtgatgttcccgacaagcaccttgccaaggatattctaattccacccgaa
ggagaacttgatgctgaattgaggaaagtccttgtgttacgtgctggagtcactatgagg
atttatgtgccagtaagaggacggccgcctccaaagattttttggactaaagtggatgcc
aacataagagaccgggcaggaatggacatcaaatcaactgattttgatactttcctgcgt
tgtgaaaatgtcaataaatacgatgctgggaaatatgtcttgcatttagagaacagctgt
ggcaaaaaatcatacaccattgtagtcaaagttcttgatactcctggtccccctattaat
ctggttgtaaaagaagcatctaaagattctgctttcatctcgtgggagcctcctctaata
gatggtggcagcccagtgaagaattacgtggttgaaaaacgtgatgcagaaagaaaatcg
tggtctacggtggctacagaatgtccaaaaaccagttttaggatttctaacttagaagaa
ggcaaatcctatttcttcagagtttttgctgaaaatgaatatggcattggtgacccctgt
gaaactcgtgatgctgtcaaagcttcagaaacacctggacctgttgtagacttaaaagct
ccacaggtgacaaagtcatcctgcaatttaacttggaaaaagcctataagtgatggtgga
agtcgtattaatgcatatattgttgagctcctgaccggtgaaaaccagtggcaagaagtt
atgagatctataactcttcactattcaacaaaagacttgaaagaaggaaaagaatacctt
ttcagagtgagagcacaaaatgaagctggatacgggacaccaaatgaaattacagtgctg
gcaagggatgatattgtggcacctgatcttgatttaagagacctcccaggcttgtgctat
ttggctagagaaggaagctctttccgtctgaaaattccaatcaaagggaagccagtacca
acggtgacatggaggaaaggagaagaccttcctttaaccgagacgggaagagtggccttt
gaagctacagcagttaacacgtcactccttgttcgtgactgccataaaagcgatgctgga
aaatatacgattacactgaagaatgttgctggcagtaaagaaggcatgatttccgtaaaa
gtggttggcaaacctggaattccaacaggccctgtgaaatttgaagaagttacagccgat
gctatgacattaaaatgggctcctcccaaagatgatggcgggtcagaaatcacgaactac
atccttgagaaaagagacaatgtgaacaataaatgggtgagctgtgtctctgctgtgcag
aagaccacctttagagttacaagacttcatgaaggctctgaatatacgttcagaatcagt
gctgaaaataaatacggtgtcggtgaaggtctaaaatctgaacctgtaattgcaaggcat
ccatttgatgttcctgatgctcctccgccacccaaaattattgaggttaggcatgattct
gcatctctgacatggacagaccctaaaaagactgggggctcaccaataacaggctatcat
cttgaattcaaagaaagaaacagtattttgtggaagcgagcaaacaagacacctctaaga
atgaaagacttcagagtgacaggactaactgaaggcttagaatatgaattcagagtaatg
gcaataaatctagctggggttgggaaaccaagtctaccgtctgaaccaattgtggctctt
gattcaattgatcctcctgggaaacctgaagttatcagtgtaactcggaactcagtaact
ttggtctggacagaaccaaaatatgatggtggacacaaattaattggctacatagtggag
aaacgtgatctaccttccaaaacctggatgaaagcaaatcatgtgaatgttcctgaatgt
gcatttacagtgactgatctttatgaaggctcaaaatatgacttcagaattagagcaaaa
aatactgctggagccattagcccaccatctgaacctacaggagccattacatgcaaggat
gagtatgaggcaccaactattgtcattgatccaactatcaaggatggcttaactgttaaa
gcaggagacaccattgcaatgtctgctataagtattcttggcaaaccacttccaacttca
gtctggtcaaaagcaggaaaagactttaagccttcagagactgttcacattgaatcaaca
ccaacttcttctgcccttactctcaagtatgctgccagaaaagattcgggcgaatataca
atcactgcaactaatccttttggtactaaagaagaacatgtgcatgtgaaagttttagat
gtaccaggtccccctggaccaattgaagtcagtaatgtctctgctgaaaaagctactctc
acatggactcctcctacagaagatggtggatctccaatcaagtcttatgtgcttgaaaag
agagaaactagccgactgctatggactcaggttgctgaagacatccagtcttgtagacac
gttgtctctaaacttattcaaggaaatgaatacctgttccgtgtctcagctgtgaaccaa
tacggcagaggagaaccatctcaatcagagccagttaaaatggtggacagatttggccct
cctggtccccctggtaaaccagaaacatcaaatgttacaaaaaatagtgtgacggtgagc
tggaagaggccgatagatgacggtggcagtgagataacaggttaccatctggaaagaaga
gaaaagaaaggtgtgagatggattagagtttcaaagaaaccggtgtcagatcttagatac
aaagtaactggactactagaaggaaatgaatatgaattccgtgtcagcgcagaaaacaga
gcaggaattggaccaccaagtgatatttcccaaccagtgctaattaaagatgctgcatat
ccaccaggacctccagcaaatccacgagtaactgatacgacaaaaacaagtgctagccta
gcatgggggaaacctcattatgatggtggacttgacattattggctacattgtagagcac
caaaaagaaggagaagaaacatgggtgaaagataccacaggaactgctctaagaataaca
gaatttgtggttgctaatctccacccaggagtcaaatacaatttcagaataagtgctatc
aatgcggctggcgtgggcgaaccagcattaattccaaatgttgaaatcagagaacgtgaa
gtgtctcctgattttgaattggatgctgaactgagaaaaactcttgttgtcagagccgga
ttgagcattaggatatttgttccaattagaggacgcccaactcctgagattacatggacc
aaagatgacatcccacttaaagcacgagccaatattgaaaatacagattcattcactctc
ctcattatcacagaatgtaatagatacgatgcaggaaagtatttgatgacccttgaaaat
gctgctggcaagaagactggctttgtaaatgtaaaagttttggatacaccaggaccacca
ataaatctgaagccccgagacatatctaaagatagcattactctccaatgggatatgcct
ctaattgatggaggttcacgtataacaaattatatagtagaaaaacgtgaatcaacacgt
aagtcatattcaaccatcacaaccaaatgcccaaaatgttcccttaggattcctggtttg
gctgaaggctgtgaatattacttcagagtatttgctgaaaatgaatttggaattggtgaa
cctgctgaaactgctgaacctataagagcatcagaagcaccatcacctccagacagcctt
aacattatggatatcacaaggaactcagtcagccttgcttggccaaagccagaacatgat
ggtggtagcaagattaccggctacgtaattgaagcacagaaaaagggttcaactcagtgg
acacacattactacggtgaaaacattagaatgtgtggtaaagaatctaactgaaaatgaa
gaatatactttccaggttatggcagttaacagtgctggaagaagtgatccaagagaaagc
aggccagttgttgttaaagaacaaatgatgcttcccgagtttgatttgcgtggtatctat
cagaaaaccataattgctagagctggtgacaacatcaaagttgagattcctgttcttggt
cgccccagaccaactattacctggaaaaaggaagatcaattgctcaagcagacacaaagg
atcaactatgaaaatacggcaactgcaaccattttgaacattaatgaatgcacaagaaac
gacagtggcagatatccggtctctgctaaaaacattgttggtgaagttagtgaagttata
actgttcacgtgcacgatgttcctggaccacccactggaccaattagatttgaagaaatt
tcatctgattttgtcaccttttcatgggaacctccactcaatgatggaggggttccaatt
agcaactatgttgtagaaatgcgcaaaactgacagtacctcctgggctgagttagcaacc
actgttatacgtaccacctacaaagcagctcacctgactactggaactgagtatcaattc
cgtgttaaagctcagaacagatacggctcaggtccggctatcaattcagagaatgtaatt
gctagctatccttttaaagtgcctgggcctccaggcactcctcagatcattgcagtcaca
aaagactctatcagcattagctggcatgaaccccttacagatggtggaagcccaattttg
ggctatcacatcgaaagaaaagaacgaaacagcattctttggcagactatcagcaaagcc
ttaatatcaggcaacaccttcaaatcaagtgggctgatggatggcattgcatatgaattc
agggtcattgcagaaaatctggcaggcaaaagcaaaccaagcaagccatctgaaccaacc
cttgctctcgatcctattgatcctcctggaaagccaatccctctaaacatcacaaggcat
gcagtagcattaaagtggacaaaaccagaatataacggaggctttaagataactggctac
actgttgaaaaaagagatcttccaaatggccgatggctaaaagcaaactttagcaatata
ttagaaactgaattcactgtgagtgggcttaccgaagatgctgcttatgaattccgtgtc
atcgctagaaatgctgctggcgccgttagccagccttctgagccatcagatgcaataaca
tgcagggatgaaattgaggcaccaagaataatggttgacgctaaatacaaagacactcta
gtagtaaaagcaggtgaaattttcaaacttgaagcagacgttgcgggtcgacctccacca
actctaacatggacaaagcaagacaaggaacttgaggatacagcaaaattggaaattaaa
atagcagatttctctacagttcttaccaataaggactccacaagacgggatggtggtgca
tatacgcttacagcatccaatccaggtggctttgcaaagcacattttcaatgtcaaagtt
ctagacagacctggtcccccagagggacctttgtcggtgtctgatgttaccatagacaaa
tgtgtcctgacatggctgccacctttagatgatggaggtgccagtattgaccactatgtt
gttgaaaaacgtgaaacaagtagattggcgtggacttctgtagccacagaagttcctgta
acaaaactgaaagtcacaaagctattgaaaggcaatgaatatgtgttccgagtaatggct
gttaataaatatggagttggcgaagctctagaatcagagcctgtcctagcagtgaatcct
tacgtagtacctggtcctcccaagacacctgaagtcacagctattaccaaagattctatg
attgtatgctggggacatcctgattcggatggaggaagtcctataaccaattacattgta
gaacgtcgtgacagagctggattacgctgggtgaaatgtaataagcgggttgtgacagat
ttgcgtttcaaagtttctggacttacagaaggccatgagtatgaataccgaataaaggct
gaaaatgctgccggtgtaagtgagccaagtcctagtagcccattctacaaagcttgtgac
actcttttcaaacctggtccgcctggtaatccccgtgtcttagatacaagcaagtcatca
attacaattgcttggaataaaccagtatatgatggtggctcagaaattactggctacatg
gttgaaacagcattatctgatgaagatgagtggaaaattgtaacaccaccagctggacta
aaggccacctcttttactatcattaatctaaaagaaaaccaggagtacaaaatcagaatt
tacgccatgaattccgaaggcattggtgagcctgctcaagttcctgggacaccaaaagct
gaagaacgaatgcttccccctgagattgaacttgatgcagagctgcgtaaaattgtgact
cttcgagcttgttgtactttgagacttttcgttccgattaaaggaagaccagcacctgaa
gtaaaatggtcacgagaacatggggaatctttagacaaagccataattgaatccacaagt
tcttacactttacttacggttgcaaatgtgaatagatttgacagtggcaaatatatgttg
acaatagaaaacagttcaggtagcaaatctgcttttgtaattgtaagagtcctcgacaca
cctggtgccccgcagaatctgaaaataaaggagatcaccatgtcatctgtcacactcacc
tgggagcctcccctcatagatggtggctctaaaataaagaattatattgttgaaaagcgt
gaagcaacaagaaaggcatactctactgttatagccaattgccacaagaccagctggaaa
gtggacatgctacaagaaggttgcagctattacttcagggttctagctgaaaacgaatat
ggaataggtcttcctgttgaaacatcagaatcagttaaagtgtctgagaggcctctgcct
ccagggaaaataactttattagacgtgacaagaagcagtgtgtctttgagttgggaaaaa
cctgagcatgatggaggaagcagaattttgggctacattgtagaaatgcaaagcaaaggc
agtgacagatgggctacttgtgccactgttaaagtcactgaagccactataaaaggattg
atccaaggggaagaatattccttccgtgtttcagcacaaaatgaaaaaggaatcagtgat
cctcggcaactcagtgtacctgtcattgccaaagatcttgtgatacctccagcattcaaa
ctgttgtttaccacattcagcgtactagcaggtgaagacttaaaggttgatgttcctttt
gttggtcgacccaaaccaactgtaacatggcttaaggatgatgtgccactaaggcaaact
actagagtaaatgaagaaaatacagaaagtaacacagtgctaaccataaaggaagcatgt
aaagaagatgttggaaaatatttggtaaaactttcaaattctgcaggagaagcaaccgaa
attctcagtattattgtcctcgataagccaggcccacccactggaccggtgaagatggat
gatataactgcagatagtattaccgtttcttgggagccacctaaatatgatggcggcagt
tccatcaacaattacattgtagaaaaacgtgacacatctactactgcttggcagattgtt
tcagcaactgttgcacgaacaactctaaaagtgagtagattaaagactggaactgaatat
caattcagaattgctgctgaaaacagatacggaaaaagtacatatctcacatcagagcct
gtggttgcccaatatccatacaaactacctggcccacctggaactccatacgtaccagaa
gtctccagagatactatggtggtacattggaacgagccagtcagtgatggtggcagccga
attattggctatcatttggagcgcaaagaaagaaacagcatactatgggttaaactgaac
aaaacagcaattcctgatactaaatttaaaacaaccggacttgaagagggacttgaatat
gaattcagagtttatgcagaaaatattattggtattggaaaggcaagcaaatgttcagaa
tgttacacagctcatgatccttgtgatccccctggccgtccagaaccgataattgtcaca
agaaattctgttactcttcagtggaagaaaccggcgtatgatggtggaagcaagatcaca
ggctacattgttgaaaagaaagaattaccagaaggccgctggatgaaagcaagttttact
aatgtaattgagactcaatttgcagtaactggcctggttgagaatcaaagatatgagttc
cgtgtgattgcacgtaatgcagctggtgttttcagtgagccctctgaaagttcaggggct
atcacagtgagagatgaagtagaaccacctcgtataagtatggatcccaagtttaaagaa
acacttacagtgcatgctactgaatcatttaagattgacgctgatgtttatggcaaacca
ctgccttctattcagtggctgaaaggtgacaaggaactaacaaacacagcacgtttggat
ataaaaagtactgactttgccacaagcctaagtgtgaaggaagctgttcgtattgacagt
ggacattatatattgttggtgaagaatgttgcaggtgaaaaaactgcttccgttcatgtc
aaagttcttgacagacctgggccacctgaagggcctgttgttataacagggacaactgct
gaaaaatgtatgctatcatggaagcccccactgcaggatggaggcagtgacatttcacat
tatgttgttgaaagaagagaaacaagtcgcttagtttggactttagctgatgccaacgtg
caaactcttagttgcaaagttactaaactcttggaaggcaatgaatatatcttccgtatc
atggctgtcaataaatatggggttggcgaacctcttgaatctgagcctgtacttgcaaaa
aatccttttgtggtaccacttccaccaaaggctccagaggtttcagctgttaccaaggat
tctatgattgttgtatgggatagaccagcttctgatggaggcagtgaaattttgggttat
gtgctagaaaaacgtgacaaagaaggcattcggtggacaagatgtaacaagcgtctgata
agtgaacttcgctatcgagtcacaggacttctggaaaatcatgactatgaatatagagtc
tctgctgaaaatgcagctggtctcagtgaacccagtccaccttctatctactataaagct
tgtgaccccatatataaaccaggtccaccaaataatcccaaagcaatagatgttacaaga
tcttcagttttcctttcttggggtaaaccaatctatgatggtggctctgaaattcaagga
tacattgttgaagcctgtgacgtaagtgttggcgagtgggcaatttgtacaccaccaaca
ggaattaagaaaacaaatatggaagtagaaaaattgttggaaaaacatgaatacaaattc
cgaatttgtgctgttaataaagcaggtgtaggagagcatgcagatgttcctggaaccatc
cttgttgaagaaaaattagaagctcccgatcttgaccttgacttagaactgaggaaagtg
atcaatgtaagagctggtggctcattaagattatttgttcctatcagaggccgcccaaca
cctgaagtaaaatggagtaaagtggatggtgatatcagagaagcagctattattgacagt
accagcagcttcacctcacttgttcttgataatatgaatagatttgactctggaaaatac
actcttactttagaaaatagtagtggaacaaaatctgcctttgtcagtgtaagagtcttg
gatactccaggtcctcctgttaacttgaaaatcaaggaaattaccaaagactctgttaca
atttcatgggagcctccagtgatagatggtggagctaaaattaaaaattatattattgaa
aagcgtgaagccacaagaaaatcctatgcagctgttgtaacaaactgccataaaacatcc
tggaaaattgatcagctccaagagggttgttattattacttcagagtttctggagagaac
gaatttggaattggcctgcctgctgaaacaagtgatccagttaaggtggctgaagttcct
caacctccgggaaaaataacagtggatgatgttacaagaaacagtgtttcattgagctgg
gcaaagcctgaacatgatggtggaagtaaaatcttacagtacattgtagaaatgcaagtt
aagggtagtgataaatggtcagagtgcacacgtgttaaagttcttgaagcagttattact
aatctaacccaaggaggagaatatctcttcagagtaatggctgtaaatgaaaagggcagg
agtgatccacgatcgcttgcagtaccaataaccgctaaagatcttgttattgaaccagat
gtcagaccagcattccacagttacagtatacaagtaggacaagatttaaagatcgaagta
ccaatatttggtcgacctaagcccactgtttcttggagcaaagatggcattccattaaaa
cagacaaccagagtaaatgtaattgattcacctaatcttactgttctaaatattaaagaa
acaaataaagaggacaatggaatatatgaaatttcagttgctaatgtagttggacaaaaa
tctgcatccattgaagttataacactcgataaaccagattctcctaaaggcccagttaaa
tttgaagatattagtgctgaaagtgtcacattatcatggaatcctccagtatacacaggc
ggttgccaggttactaattatattgttcataagagagatacaaccacgacttcatgggaa
gtagtttcagctactgttgcaagaactactctgaaggtgactaagctgaaaactgggtca
gaatatcaatttagaatatttgcagaaaatagatatgggcagagctttgccctggaatct
gaaccagttgttgctcaatatccctacaaagaaccaggcccccctggaacaccatttgtg
acaatagctacaaaagactctatgattgtgcaatggcatgaaccaattaatgatggtgga
agtagaattctaggttatcatcttgaacgaaaggaaagaaacagcattctgtggacaaaa
gtaaacaagactattattcaagatacacattataaagcaactaatcttgaagaaaacatt
gaatatgaatttagagtttctgcagaaaatattgttggtgtaggcaaagcaagcaaagtt
tcagaatgctatgtagcacgtgacgcctgtgacccaccaggttgtccagaagctattgtt
gttacaagaagtgccatcactctgcagtggaccaagccggaatatgatggtggcagcaaa
ataacaggctatatagtagaaaaacgagacttacctgatggtcgatggatgaaagcaagc
tttaccaatatcattgaaactcagtttactgtgacaggtcttactgaagaccaacgatat
gaatttagagtaattgcaaggaatgctgctggagcagtaagcaaaccttctgacagcaca
ggacctataacagcaaaagatgaagttgaacttccaagaatttccatggatccaaaatac
aaagatgcaattgttgtaactgctggcgatactttcaaacttgaagctgatgtacatgga
aaaccaattcctactattatgtggctgaaaggagataaagtccttgaagatactgctcga
tatgaaataaggaatacagatttcaaggctctgattactgtgaaagacgctatacgtgtt
gatggtgggcagtttattttgcaggcaaccaatgttgcaggaacaaaatcagtacctgta
acagtaaaagtactagataggccagggcctccagagagtattcagatttctggagttact
tctgaaaagtgttccttagcatgggttccaccaatccatgatggtggcagtgatatttcc
cactacataattgagaagagagaaactagtcgtcttgcttggacagttgttgcatcagat
gctgtagccacaatgctaaaggtaacaaaacttttggaaggcaatgagtatatattccgc
ataatggcagttaataaatatggaattggcgaacctttggaatctgcacccgtacttatg
aaaaacccatttgttgttcctggttcaccaacataccttgaagtcaccaatgttacaaag
gattctatgacagtctcttggcatcgtccagatagtgatggtggcagtgaaatcattggc
tacattgtagaaaaaagagatagaactggtattagatgggtgaaatgtaataaacgtcga
attacagatttacgattaagagtcacaggactaactgaagatcatgaatatgaatttaga
gtatctgctgaaaatatagctggaattggtgaaccaagtcaagttactccatactggaaa
gcatgtgatcctatgttcaagcctggtccacccactaatgcccatgttgttgatacaacc
aagaattcgatcacagctgcatggggtaaacctatttatgatggtggctgcaaaatccta
ggatatattgtagaaatctgcaaagctgatgaagaagaatgggcaatggttactccacag
actggtctgagaatcaatcgttttgagatcaaaaaactcatagaacaccaagaatacaag
ctaagggtgtgtgctctcaacaaaattggagtaggtgagcctgcagcaattcctggtaca
attaaaccagaagataaacttgaagctcctgaacttgatatagactcagaattaaggaaa
ggaattgttgtcagagctggtagctctgtcaggatcaatataccatttaaaggacgccct
actcctgaaatcacatggtctcgtgaagaaggggaatttacagataaagttcaaattgaa
aaaggaataaattacacacagctatcaattgattattgtgatagaaatgatgctgggaag
tatatacttaaactggagaatagcagtggttctaagtctgcatttgttacagttaaagta
cttgacacaccaggaccaccacaaaacttaatagtcaaagaaataaggaaagactatgcg
gtagtgacgtgggaacctccagctaatgatggtggagcaaagataaagaactatgtcatt
gataaacgtgagtcaaccagaaaggcatatgcaaatgtgagtgccaagtgcaacaaaaca
agctttagagttgaaaaccttacagaaggaagcatttattatttcagagttatggctgag
aatgaatttggaattggtagtccagctgaaactgctgatgcttcaaaagcatcagagcca
cctctaccccctggaaaagtgacacttactgatgtgacgcagagaagtgcatcgtttatg
tgggagaagcctgaacatgatggaggtagcaggattttgggctacattgttgaaatgcag
tcaaaaggatctgataaatggactgttgttactgaaagcaaagtctgcaatgcagttgta
tctggtttgatttctggacaggaatatcagttccgtgtcatggcatacaatgaaaagggc
aaaagtgatcctaagccactggcagttcctgtgattgccaaagatcagacaattcagccc
agtttcaaactgatgttcaatacatatactgtacaagctggagaagatcttaaagtagaa
attccctttatagctcgaccaaagcctactatcgcttgggagaaagacggccagcctcta
aaacagacaaccagattacatgttgaagatacagcaacttcaactacattgtttattaaa
gaaagcaacaaggatgattttggaaaatatactgtcacagcaaccaacaccgcaggcaca
gcaacagagcatcttagtataattgtgctagaaaagcctggcccaccccaaggacctgtc
cgctttgatgaagttagttcaaacttcgtagtcctctcatgggaaccaccagcatataca
ggtggctgtcagatatccaactacattgtcgagaaacgtgacactacaaccactgtttgg
caaatggtatcagcaatggttgcaaggacaactattaaagtaacaaaacttaaaacagga
accgagtaccaatttagaattagcgctgaaaatcgatatggaaagagcagtgcactagat
tctaagccagttcttgtacaatatccatacaaagtaccagggccaccaggaaccccctat
gtcactacagccaccaaagatcacatgatagtacaatggcatgaaccagttaatgatgga
ggaagcaaagttcttggatatcatctagaacgtaaagataaaaacagcatcctttgggca
aaggtgcacaaggcccttatccaggacacaaaatataaaacagatggtcttgaagaaggt
cttgaatatgaattcagagtttctgctgaaaacattgttggagtaggcaaagttagcaaa
tgttctgaactgtatgttgctcgggatgcttgtgatccaccaggccgtccggatgccatt
gttatcactagaaattacgtaacactaaaatggaaaaaacctgaatatgatggtggtagc
agaataactggatacactgtggaaaagagagaattacctgaaggccgttggatgaaggcc
agttttacaaatgtaatagaaactgagtttacagtaagtggtcttgtagaagaccaaaga
tatgaattcagagtaattgcaagaaatgcagctggtagcttaagtgaaccctctgaaagc
acagggccaattattgctagagatgccatagaagcaccaagagcttcactggatcctaaa
tataaagatctcattgttgttcgtgcgggagaaacatttgctcttgaggctgacatccac
ggaaaacctattcctgatgttaagtggtcaaaagatggaaaagaatttgaagaagcaacg
gcgagaatggaaattaagtctacaattgaaagaacaactctcacagtcaaagactgtgtc
agattagatggaggccaatacacacttaccctgactaacgttggtggcacaaaagcaata
ccaatcactgtaaaagtgcttgacagacctggacccccagaaggccctttgaaagttaca
ggtgtgacagcagaaaaatgttaccttgcatggggaccacctttacaagatggaggtgct
agcatttcacactacattatagaaaagagagagacaagccggctttcatggacacaagta
tcatctgatgttcaggctctgaatcacaaagtaaccaaacttctttcaggcaatgagtac
attttccgtgtaatggctgttaataaatatggaattggtgaccctctggaatcagaacct
gtattggcatgcaatccatataagcctccaggtcctccttccacgcctgaagcttctgca
atcacgaaagattctatgattgtaacctggtgccgcccaattgacgatggtggagctgaa
attgaaggttatatactagaaaagcgagacaaagatggcattagatggaccaagtgcagt
aaaaagagactgacagacttaagattgagagtaactggactgacagatggtcatttctat
gaatttagagtttctgctgaaaatgctgctggtattggtgagcctagtgaaccatcaatt
ttctaccgtgcttgtgaggcaatatatccaccaggccctccaaacaatccaaaggtaaca
gatacctccagatcatctgtgtccctggcatggggcaaacctacttatgatggtggcgct
cctgttaaaggatatattgtagaatttaaagaagctactgctgatgaatggacaacttgt
acacccccatcaggtttacaaggaagacaattcacagtaacaaaacttaaagaaaatagc
gagtataacttccgcatttgtgctatgaattctgaaggggttggagaaccagcaactatc
cctggtagtgttgttgcggctgaaaaaatggaacctcctgaaatagaacttgatgcagat
ctcagaaaagttgtcacagtgcgtgctagtggcacattacgtttgtttgtcacaattaaa
ggaaggccagagccagaggtgaaatgggaaaaagcagaaggcactctgagtgacagggct
cagattgaggtaaccagttcttatacaatgttagtaattgacaatgtaaacagatttgac
agcggaaaatataacctgactttggaaaacaacagtggcaagaaaacggcatttgttaat
gtgagagtacttgatacaccaagtgcacctgtaaatctgaccgtcagagaagtaaagaaa
gatttagtgacactagcttgggagcctcctcttattgatggtggagctaaaatcacaaac
tacataattgaaaaacgtgaaacaacaagaaaagcttatgccactattacaaataattgc
agcaaaaatgtcttcagaatcgaacagctacaggaaggatgcagctactacttccgggtc
ttagctgcaaatgaatatggtgttggtttgccagcagaaacatctgaaccagttaaggtt
tctgaaccaccctatccacctggaaaagtaactcttgtagatgttactcgtcacagtgct
actattaaatgggagaaaccagagagtgatggtggcagtaaaataactggctatgtagta
gaaatgcaaactaaaggaagtgaaaaatggagcacctgtatccaagttaaaaccttagaa
gcaacaatatctggattaagtatgggagaagaatacactttccgtgtctgcgctataaat
gaaaaaggaaagagtgatccaagacaacttggagtcccagtagttgcaaaggacattgaa
atccagccttcagttgagctccttttcaatacattcagtgttaaagctggtgaagacctt
aagattgatgtacccattagaggaaggccagtaccatctgccagctggaaaaaggatggc
atgcctttaagagagacaacgagagtgcatgtccaaacttcaaaaacttccacattgcta
gtaatcaaagaagcttcaagagaagatgtaggaaagtatgaattaaatgttgtaagcagt
gctggctccacaacagctatcatcaatgtaattgttcttgatagaccaggacctccaacc
tcgttacatattgataatgtcagtgctgataatatatccatatcttgggaaccccctgaa
tatgatggtggctgtcaaattaataattacattgtagagaaaagagaaactacaacaaca
acatggagcaccgtatctgcagcagttgcacgaacttcaattaaaatagctcgcttaacc
actggatcagaatatcaattccgcgtttctgcagaaaatcgctatggcaaaagcacttac
gttgaaactgcccctgttgtggcagagtatccatttaatctacctggcccacctagtact
cctcgagttgtacatgcaactaaagccttcatgattgtaaattggcaggaaccagttaat
gacggcggtagcaaagtacttggttatcaccttgaacgtaaagaacgaagcagcatcctt
tggactaaagttaataaaatccttctaagtgatactcagatgaaggtcacaggccttgat
gaaggcctgatgtatgaatatcgtgtgtatgctgaaaatattgtaggaattggcaaatgt
agcaaatcatgcgaaccagtggcagcaagggatccatgtgacccacctggccaacctgaa
gtgaccaatattacaagaacatgtgtctcactatcatggaccaagccagaatatgatggt
ggtgctaagattacaggctacattattgagcggaaagagctcccagatggtcgttggctg
aagtgcagtttcaccaatatacaggaaactttctttgatgtgaccgggcttactgaagac
cagcgctatgaattccgtgttattgccaggaatgctgctgatcaatttagtgagccatca
gactccactgggccagttactgtaaaggatgacatagaagctccaagaattatgatggat
gccaaattcagagatattgttattaaagctggagagattttaaaagtcaacgctgacatt
gctggacgacccttgccaatagtttcatggacaaaggatggcaaagagattgaagaaaag
gcaagaattgaaatagtctcaacagatcgttctacaacaatcactgttaaagactgcatt
cgacgggattcggggcagtatgtgttaacattacaaaatgttgctggaacaagatcatta
gcagttaactgcaaagtacttgacagaccaggtccaccagcagcccctctagaaattaag
ggcctgactgctgagaaatgttatttgtcatggggaccacctcaggaaaatggaggggcg
gagattgactattatattgtggaaaaacgtgagaccagtaggcttgcgtggactctttgt
gaagcagaacttccaacaacttcctgcaaagtaacaaaactacttaaaggaaatgaatat
attttcagagtgatgggtgtaaataaatacggtgttggtgaaaccttagaaagtgaggct
gtcaaggccctggatccttttactattccaagcccccctaaatctttagaggttaccaat
gtgacaaaggaatccatgactctttgttgggcaagacctgacagtgatggaggaaatgaa
atttctggttacgtgattgaaaggcgtgagaaaaacagtttgcggtggatacgtgtaaat
aaaaagccagtttatgatctcagaataaaatcttcaggccttcgggaaggatgcgaatat
gaatatagagtatatgcagaaaatgctgcaggtcttagtcttcctagtgatccttcacca
ctaataaaagcagaagatccagttttcctaccatcaccaccatctcggcccaagataatg
gaccatacaagatctcatataacaattggatggataaaaccattatttgatgggggagct
cctattattggatacactgttgaatacaagctaactagtgaaactgattggtcaactgct
attcaaagtttaagaggaacagaatacactgtaataggtcttacatcgggagcagaatat
gttttcagagtaaagtccgtgaacaaaattggcgctagtgatccaagtgaagcctcagaa
cctcaggtagcaaaggaaagagaagaagaacctgtttttgatatcgataatgaaatgaga
aagacactagttgtgaaagctggtgactcatttacaatgactgtgcctttcagaggaaaa
cctatccctaacgtactatggagtaagccagatactgatctccgtacacgagcaaatatt
gattcctcagataaccgcacctcgcttactgttgaaaaggcaacacgagatgattctgga
aagtatacactgacattacaaaacattgtaaacacagctactttgacattacttgttaaa
gtacttgattcaccaggacctccatctaatatcattgtaaaagatgtaacaaaagagtct
gctgtgttatcttgggaagctccggagaatgatggaggggctcctgtgaagaattactac
attgaaaaacgagaagcaagcaagaaagcatgggtcactgtaaccaacaattgccaccgt
ctttcctacaaagttgccaatctacaagaaggcggaatttattacttcagagtctccgga
gaaaatgaattcggtgttggtgttcccatcgaaaccaaagatggagttaaaataacagaa
aaaccaagtccaccagaaaaactgggagtatcgagcattaccaaagacagtgtatccctt
gtatggcttaaacctgagcatgatggtggaagcagaattattggctacctcgttgaagcc
ctagagaaagggcagcaaaaatgggtcaaatgtgctgtagtcaagacaacccatcacatt
gtccaaggtctcaaagagaacatggattatttcttcagagtatttgccgaaaacgaagct
ggtctgagtgatcctagagaacttcttcttcctgtcacagttaaagaaaaaatggaatca
cctgaagtggatatgaaaggtttcccgaaccatacagtttatgtgagagctggttcaaat
ctaaaggttgagattccaatttcgggaaaacccttgccaaaggtgactttatccagagat
ggcattcctctcaagccaaccatgaggtttaatacagaaaccactgcagagtgtgtaatt
attaaccttaaggaaagtatggctaccgatgctggtaaatatgacatcacagctgcaaac
tccagtggaacaacaaaatccttcatcaaaattgttgtcctggatagaccaggtccccca
attggtcctgtggtggtgagtgacatcactgaagaaggagtcaccttgaagtgggagcct
ccacattacgatggtggaagccaagtcacaaattacattgtgctaagaagagaaacaagc
actgctgtgtggtctgaggtgtctgcaacagttgctagaaatatgattaaaatcatgaag
ttaaccaccggagaagagtatcaattccgtatcaaagcagaaaatcgcttcggcattagt
gatcaccttgattcagcatgtgtagttataaaactgccttatactatacctgggccacct
tcaacaccatggatcactaacgtaactcgagaaagcatcactgttggatggcatgagcct
gtttctaatggaggcagtgcaatcattggttaccatttggaaatgaaggacagaaacagt
attttatggaagaaagtgaataaaatgattatacgcacaactcacttcaaagcctcaacc
attactgctggactaatttatgaattcagagtttatgctgaaaatgcagcaggcattgga
aaaccaagtcatccatcggatgcagttcttgcaattgatgcatgcgaaccaccaagaaac
gttcgagtcacagatatttccaaaacatttgtcagcctttcttggacacaaccagctttt
gacggtggtagcaaaatcactggatacattgtggagaaacgtgattatccaaatggaaga
tgggcaaaggccagttttaccaacgtcatagagacccagtttactgtctcaggattgact
caaagctctcagtatgaattccgtgtctttgctaagaatgccgcaggttcagttagtaat
ccatcagatgttttaggacctatcacctgtgtggatacatatggtgcacctgaaatagat
gtaccaccagaatatacagaagtggtcaaatacaaagctggcactgcggttaagctcaaa
cttgggatttcaggaaaacccataccatcaatagaatggtttaggaatggcaaagaggta
caaacaagtgcccaaatatctattgaaaataccactgaattcgcctccatactgatcaag
gatgcaactcgtctcaatagcggaagctatgaactgaaattaaagaatgccatgggctca
gcatctgctactattaaagtacaaatacttgataagccaggacctccatgtgggcctgtt
cactttaaaacagtcactgctgaaaagatttctcttctgtgggaaccaccagctgacgat
ggaggtgccaaagtgacacattacgttgttgaaaaacgtgaaacgagccgcgtggtatgg
tctatggtttcagaaaaacaagaagaatgcgatgtcactaccaccaaagtcataaaagga
aatgaatacgttttccgtattcgagcagtaaacaagtttggtgttggcgatgcactggaa
tctgagagcgttgtagctaaaaatagatttgttactcctggacaacctggtgtgccagag
atcaccatgataaccaaacagtcaatgactgtaagctggaccaggcctactgtggatggt
ggtagtgaaataagtggatattatcttgaaaagcgtgataagaaaagcctaggctggttc
cgagtcgttaaagaaaccgttcgggacaccagacagaaagtcacaggactaactgaaaac
agcgaatatcagttcagagtctctgctgtgaatgcagctggccaaggccctttctctgaa
gaatctgactttttcaaagctgcagatccgatcgaaaagcctgggccacccgttaagcta
aaggttgtggatactacaaagacatctatcacacttagctggactaaaccagcttatgat
ggaggaagtgcaattaccagctatgctatagaaaagagagaaggtgatgaagaagaatgg
tccatagtgagtgcaagaggagaagtgagaaccacagaatatgttatttctcaacttcag
ccaggactcaattactacttccgtgtagctgctataaattgtgctggacaaggcgaacct
attgaaatgacagaacctgtacaagctaaagacattcttgaagagccagaaatcgatttg
gatgtggttctcaagacctccattgtagctaaagcaggtcaagacgtgcaaataatgatc
cccttcaagggaaggccacctccaactgtcgtatggagaaagggtgacaaaaatcttagt
gttgacgaaagatacatcatccagaacacagaatcatctactcttcttagtattcctcaa
gtcactcgcaatgatacaggaaaatacacccttacaattgaaaacggagttggaaaagcc
aaaacctcctttgtgaacgtcaaagtgcttgacactccatctgcatgccagagactgcac
ctcaaaaatgtttctcgtggaactgtgactatggtatgggaaccaccactcataaatggt
ggttccgaagttacaaattacgtcattgaaaaaagagatgctacaaagagagcttggtct
tctgttacagcaaagtgctccaatacatcctttaagataagtgacttatcagaaaagatc
ccatacttcttccgcgttcttgcagaaaatgaaaatggattaggtgaaccatgtgaaact
ttggaaccagtgaaggctgcagaagtacctggacccgtgagggatttaatcatgaaagat
tcatccaagacctctgtcaccctacagtggaccaaacctgagtttgatggtggtagtatc
atctccgagtatattattgaaaaaagattgaaagatgaaacggaatggtcatatgcaggc
ataagcaaggcatgtgaatttgaagtggaaaaacttaaggagctttctgttatggatttc
agagtgtcagctaagaatgaaaaaggaagaagtgatggtgttacaattgggccaattaca
gtgaaagattatgtaataacacctgaagcagatctttctgatatacctggaggacaggta
acagtgagaataggttacaatgtccatcttgaattgccatataaaggaaagcctataccc
agtatgagttggctaaaagacaacatgcctcttaaagaaagcgaactggttcgcttcaag
aaaacggaaaacaaaataacattaagcattaagaatgtgaagaaagaaaatggtggcaag
tacaccttaattcttgacaatgtcgtccacagaaagtcattcccgtttacagtgatcaca
cttggcccaccatccaagccaaaaggaccaatcaagctagatgaaatcaaagcagacagt
gtgattctttcatggaatcctcctgaagatgacgggggaggagaaattacaggctacagt
gtggagaagcgagaaacttcacaaaccaattggaaaatggtctgctctagtgtatcaagg
acaacattcaaagttccaaacctcgtgaaagatttagaatatcagttcagaattcgtgca
gaaaatagatacggagtaagcccaccacttaactcagtagaggtcatagctaagcaccag
tttaagccaccaggttcaccaggaaagcccgttgtttacaatataacagctgatggaatg
accatatcttgggatgctcccctttatgatggaggtgcggaaattactggataccacgtg
gagaagaaagaaagaaatagcatcctgtggcagaaagtaaatatctcatcaatatctggt
cgagaatacagaattactggactaatggaaggcttggactatcagttccgtgtatatgca
gaaaattctgctggactaagccctgctagtgatcctagcaaactccatctggctgtttcc
ccagttgatccacctggcactcctgattatattgatgtgacaagagagacaattactctc
aaatggactgcaccagtgcgtgacggaggcagcaagattgcgggttatagtgttgagaga
cggcaaggacctgaagaccgttgggtcagatgcaattttattgatgtcagtgaatgccaa
tatacagttacaggacttagccctggggaccgatatgaattccgaatccttgcaagaaat
gctgttgggacgatcagccctccttctcagtcttcaggctatatcatgacccgagatgat
gctgttgcacccaatattgaatttggtgctgaacattttgagggtcttacagtcaaagca
ggtgaaagcataagacttaaagcccttatcacgggccggcccgttcctcaagtgacctgg
tttaaagatggagaagagattgacaagcgattgggcgttgaaataaccagcgctattggc
tatagtaccatatttgttagagacgcttctcgagaccatcgtggagtatatcgggtggaa
gccaagaattcatcaggcaccaaacaagcaaacctaaccataagagtccaagatactcca
gggaaaatagggggcccgatacgcttcaccaatattactgaagagaaggcaacactgtgg
tgggagcctccagctaacgatggctgtgcagccattactcattatgtaatagaaaaacgt
gaaaccagcagagtatcctgggcgctaattgaagaccactgtgaagcctgcagctacgta
gcacttagattaataaaaggcaatgaataccagttccgaatctctgcagctaacaagttt
ggggtcggcagaccactggaatctgatcctttcgtagcacaagcacattacactgttcct
gatgcacccgggactccagagcctagcaatgtaacagggaacagcatcactctcacctgg
acaagaccaaaatcagatggtggaagtgacattgatcaatatatcttggagagaagagaa
aaaaagagcattctctgggtcaaagtatccagcaagagacccatttctgagacaagatat
agagtcacagggctaactcagggcaatgaatatgaattccaggttatggcagaaaacaag
gctggcgtggggccacctagtggtgtgtcgaggttgattaaatgcagagacccagttcat
ccaccaggtcctcctactgtggtcaaagtgatagatacatcaaagacaagcgtcacctta
gaatggacgacaccagtttttgatggcggcttggaaattattggctacatcattgaaatg
tgtaaagctgatttgggagattggcataaagtcaatgctgagactttaatcgctaccaaa
tatactgtgactgacttagaaccaaatgagcattataagttccgagtcagtgctgtaaat
actgcaggcaaaggagaaagctgtgaagttgctgcttcagtacaaacagtggataggctt
tcttcccctgaacttgatattgatgctagcttcaagcagactcacataatccgagcaggt
acaaatatccgtctctttattgccttcaagggcagacctgttcctattgctacatggtcc
aaagcagattccgatctcaacttacgagctaacattcacacaacagattcattcagtaca
ttaactgtagagaattgcaacagaacggatgccggaaaatatgtgtttactgtagaaaac
aacagtggtagcaaatctattgctttcacagttaaagtgctagatactcctggaccacca
ggtcctattacatttaaggatgtgactagaggctccatcactttaatgtgggatgctccc
attttggatggaggtgcacgtatccatcattacgttgtggagaagcgagaagcaacccgc
cgtagctggcaagttgttaatgaaaaatgtacccgccaaatagctaaagtcactgatctt
gcagaaggtgtaccctatttttaccgtgtctcagcagaaaatgaatacggactaggtgaa
ccgtgtgaattaacagagccagtggtggccactgaagaacctgctccacctaagagatta
gatattattgatactactaggtcatctgtggtacttgcttggcttaaacctgaccatgat
ggtggcagccgtatcactggatatctgctagagatgaaacagaaaggaactgaagtttgg
cgtgaagcaggtcaaaccaagcagcttactttcacagtagaaggtcttactgagaacaac
gaatatgaatttagggtcagtgcaaagaacgatgctggctacagccagccaagagaagct
ttttcctctgtcattattaaagagccacagattgaaccaaccgcagaccttagtggaata
actaaacaacttataacttgcaaagctggaagcacgttcactattgatataccaattagt
gggcgccctattccaaaagtaacctggaaacttgaggaaatgagactcaaggaaactgat
agagtgactatcaagacaaccaaagatagaaccacactgattgttaaggacagcatgaga
ggtgattctggcaaatactatttaactcttgagaacatggctgggatgaagacattcact
gtcaccgttatagttatcggaagaccaggtccagttacacgccccatagagatatcatcg
gtgacagcagaatcctgtgtcttgtcctggaaggaacctgaagatgatggtgggactgat
attactaactacattgttgaaaaacgtgaatctggtacaacagcatggcagctcataaac
tccagtgtcaagcgtacacagatcaaagttactcatctcactaaatacatggaatatact
ttccgtgtcagttctgaaaaccgatttggcgtcagcaaacctgttgaatcagttccagtg
gtggctgagcatccatttgtccctccaagtcctcccacaagacccgaagtctattttgtt
tcggccaatgccatgtctatccgatgggaggaaccatatcatgatggtggcagcaaagtt
gtgggatactggattgaaaagaaagaacgcaacacaatcctttgggtaaaggagaacaaa
gctccatgctttgagtgtgactacaaaatcactggacttgtagaaggtctagaataccag
ttcagaacatatgcattaaatgctgctggagtgagcaaggccagtgaagcttctagacca
attgtggcccaaaacccagttgatccaccaggcagaccagaagtgacagatgtcacacgg
tcttcagtttcattaagctggacttctccactttatgacggtggaagcaaaattgttggc
tatattgtagaacgcaagccctaccatttgactggagatggacgctggttgaaatgcaat
tacaccattgtttcagaaaacttctttaccgtaacagccctcagtgaaggagaggaatat
gaattccgggtcttagcaaagaattctgctggtgtgattagcaaaggttctgaaaccaca
ggtcctgtcacctgcaaagatgaatattcaccacctaaagctgagctggatgccaaatta
aaaggagatattgtaactgttagggctggatctgatcttgttcttgaggcatcgatcggt
ggaaagcctgaacccaaagtgttttggtctaaaggcgacaaggagttggatttatgtgaa
aagatctctttgcaatataccagcaggcatgctgtcgcaatcatcaagttctgtgacaga
agcgatacaggaaaatacacattaactgttaaaaatgctagtggaacaaaacaagtttct
gttttggtcaaagtacttgattctcctggtccatgtgctggcaagatcaccattagcaga
gtgacagaggagaaatgtaccttggcttggaatgctcctcaagaagatggaggggcagaa
attactcactacattgtggagagacgtgagactagcaggctgaattgggttattgttgat
gcggagtgtgcaaccctctcgtgcgtaacaacaagacttatcaagaataatgaatacata
ttccgtgtaagagctgtcaataagtatggacctggagtcccacttgaaacagaagcaatg
attgctagaaattcatttactattccatcacctcctgggatgccagaatcagtgggtgct
ggcaaagagcacatcattattcagtggctgaaaccagaatctgacgggggaaatgagata
agcacctatctggtagataaacgagaaaagcgaagtctacgctggacccgagtaaacaga
gactacaccatttatgacaccaggttgaaagtcactggtctcatggaaggcagcgaatat
cagttccgtgttaccgcagtaaatgctgctggcaacagtgagcccagtgaagcatctcaa
tatattttgtgtaaagaaccatcatatactcctgcacctccgtctcctccaagagttgta
gataccactaagacaagcataagcttagcttggacaaagcccatgtacgatggcggagtt
gatatattgggctacattcttgaaatgaaagaagaaggcatggaccaatggtacagggtc
catactacagccaccatacggaatcctgaattcactgtgactggtcttagacaaagccag
aaataccgctttagagtggcagccaccaacataaatgggataagtgaatacagcgagtcg
ccagccgaaatagaacctgtggaaaggctagaaatacctgaccttgagcttgctgatgac
ctaaagaagactgttactgtcagagccggtggctctttacgtctaatggtctcagtgtct
ggcagaccactaccaagaattacctggagcaaagcgggtgttgacttagcaagtcgggct
atcattgacaccacggacagctacacactcttggttgtggataaagttaaccgctatgat
gctggaaaatatgtcattgaggctgaaaatcaatcaggaaagaaatcggcaactgttctt
gtaaaaatctatgatactcctggccctccaggatctgtgagagtaaaagaaatcaccaaa
gaatctgtaactattacttgggacgttcctgccattgatggtggagcaccagtcaataac
tatatcattgagaaacgtgaggctgccatgagggcttacaaaacagtaactactaaatgc
aacaaaaccatttaccgaatttctggactcatggaaggagctctatactatttccgagtt
ctaccagaaaatatctatggtataggtgaggcatgtgagacatcagatacggtgcttata
tctgaagtcccgagtgtgccacagaaactggaggtggttgacattactaaatctactgta
tcgcttgcctgggaaaaaccacagcacgacggtggcagcagattaactggctacgtaatt
gaggccagtaaagttggaacagacaggtggatgaaagtcgtaaccctgaaacctacagtc
tttgagcatacaatcatttcactaaatgaaggagaacagtacctgtttagagtcagagca
caaaatcagaaaggtgtctcagaaccaagggaaatagtcacagccgtcactgtgcaagag
caaaaagttctacccacaattgacctggctggaattcctcaaaagaccattcatgtacca
gctggaagacctatagaattagcaattccaatttctgggcggccacctccagctgtttct
tggttctttgctggctctaaactaagagaatcagagcgtgtcaagatcgaaacagttgcc
aaactcactaaattaactgtacgcgaaacaacaatacgagatactgggtcgtacacactt
gaactgaagaatacaactggaactgttcttgatatagtcaaagttattattcttgataaa
cctggaccacccatcgggcctattagagtagttgacattgattcaacttttgtaactatt
tcctgggaaccacctgagatggatggtggtgcaacattaagtggatacgtggtagagcaa
cgtgatgcccaccgtccagggtggttaccagtatctgaatctgtaactcggacaacattt
aaattttctaaactgactgagagtgctgaatatgtattccgtgtggctgcaacgaaccgc
tttggaattggatcctacttgcaatccgagattatagaatgcaagagcagaatcagcatc
ccaggtcctcctggtactctagaagtgtttgatatctgccgtgatggaatgacacttact
tggtatccaccagaagaggatggtggttcacagatctctggctacattgtggaacgcaag
gaagttagatcagacagatgggtccgtgtaaacaaaattgctgtgactatgacacgctac
cggtcaacagggttaattgaaggcctggagtatgaacaccgtgtcacagctatcaatgct
aggggcactggcaaaccaagtagagcatcaaagcctgcagttgctatggatccaattgct
cctccaggcaaacctcagaatccaagagttacagatactacaagaacaacgatctccctg
gcttggagtccacctgaagatgaaggtggatctaaagtcactggctatttaattgaaatg
caaaagattgaccagtttgaatggactaaatgtaacaccacacccaccaaaatacgtgac
tacactctaacccatcttccacaaggggcagagtacagattccgtattgccgcctgtaat
gctggaggtcctggggaacccgcagaggtaccaggaacagccaaagtaacagaaatgctt
gaatatcctgattatgtactggatgcaaaatacctggaaggtgtatttgtaaggcaaggt
ggagtaattaagctcacagtcccaattaaaggtaaacctattccaatttgcaaatggact
aaggaagggcatgatgtcctccagagggctatgattgccacttctgaaacagatactgaa
ttggttatcaaagatgcagaaagagaagattctggtacttacgatttaacacttgaaaac
aaatgtggcaagaaggtagtctacatcaaagtcagagtcattggcattccaaatccacca
gaaggaccacttgaatatgacgacatacaagggcgctccgttagagtcagctggaagcct
ccaactgatgatggtggtgctgatctattaggatatattgttgaaaggcgtgaagtacca
aagactgcctggtacacagttgattccagagtaaaaggtacatcattggtggtgaaagga
ctcaaagaaaatgtggaataccacttccgtgtttatgctgaaaaccaatttggtgtgagc
agatctctgaaatctgaagagccagttgtgccaaagacacctttgaatcctccagagcct
ccaagctatccaccagaaatacttgatgtcacaaaaagttctgtcagcttatcttggtcc
agacctagagatgatggtggctctcgtgtcactggctattatattgaacgcaaagaaaca
tctactgataaatgggtcaggcataacaagacccacatcacaactacaatgtatacagtc
acaggactggttccagatgctgaatatcagttccgtattatcgcccaaaatgatattggc
gaaggtgaacctagccctgcttctgaaccagttgtctgcaaggatccatttgataaacca
agccagcctggagaaattgagatcatttctatatttaaagatagtattactctagaatgg
gagcgccctgagtgtgatggtggtaaggacatcattggatactgggttgaatatcgccaa
tatggacagaccgcatggaaaaaatgcaataaagaacgcatcaaagacagacagtttatg
gtgggaggcttgctggaagctacagaatatgaattcagagttttcgcagaaaacgaaacc
ggaatcagcaggccacgtagaacagcaatgacagtgaagacaaaactgacatctggagaa
actcctggagtaagacaagaaataaaggatgtcactacaaacctaggggagacaggacag
ctatcatgccagattattgggagaccgcttcctgacattaaatggtatcgttttggcaaa
gaactagtacagagccgaaaatacaagatgtcatccgatgggcgcacccatacattgtct
gtgctgacagaagagcaagaagatgaaggactttatacctgtaaggctaccaatgatgtt
ggagaaattgaaaccagtggcaagctcttattgcatgctcctccacaattccatcctggt
ttccccttgaaggagaaataccgtgcaggtataggttctactcttcgcctccatgttgtc
tacattggtcgcccagtgcctgctattacatggttccacgacaagaaacttttaaagaac
actgaaaacattacgatcgagaacacggaacattatacccacctgtccattaaaaatgta
cagcacaagacgcatgccggaaagtacaaagtgcagctcagtaacatttttggaagtgtt
gatactgtactcagtgtggaaatacaagataagcccgataaacctgtaggaccaattgtc
gtggaagctctgctgaagaactctgcagtcatcagctggaagccacctgaagatgatggt
ggtgccttcgtcacaaattacgttgtagagaaaagagaagcaaaagaaggtgctgagtgg
caactggtgtcatcaagcatatctggcaaaacctgtaggattgttaatctaattgaaaat
gcagggtattatttccgcgtctctgctcagaacgtatttggcatcagtgaagcattagaa
gtgtcttcagttgttattatcaagacaccatttgaaaaaccaggacaaccaactcagcca
aatgtatctgctattacaaaagattcctgcgttgtatcttggaggccaccagcaagtgat
ggaggctcaaagattagaaattactaccttgaaaagcgggaaaagaagcagaacaaatgg
attgctgttaccacagaagaaattcatgaaactgtctattctgtcacaagccttattgaa
ggtctggaatatgaattccgtgtaaaatgtgaaaatctgggtggtgagagtgaatggagt
gaaatttcacaaccgatcattcccaaatctgatatatcaattcaggcaccacatttcaaa
gaagaaatcagaaatctgaacgtgaaatttagaggtcatgccacatttgtttgcaaagtc
accggtcaccctaaacctgttgtaaaatggttcaggcagggcaaggagattatgccagac
ggtgaaaaggtgaagatacaagaatttaagggaggatatcatcagttggtgattacagac
gtaacagacgacgatgctactgtgtaccaagtgagagcaaccaaccaaggaggatcaatt
tctggaactgcctccttagatgttgaagttcctgctaaaatccacttacctaaaaacctg
gaaggtatgggagcagttcatgctctccgtggtgaagttgttagcatcaaaattccgttc
agtggcaagcctgatccagtgatcacttggcagaaaggacaagatctcattgatacaaat
ggacattaccaagtcattgttacaagatccttcacatcccttgttttccctaatggggta
gacagaaaagatgcaggtttctacattgtctgtgctaagaacagatttggcattgatcag
aaaacagttgaattagatgtggctgacgtccctgatgcgccaagaggattgaaagcaagt
gaggtttcaagggattctgtcaacttaacctggaatgctccagccaacgatggtggaagt
agaatcacacattatactgttgagaaacgtgctacaacagctgaaagatggatccgtgtt
ggtcaagctcgtgatacacgatacactgtagtaaacctatttggtaaaacaagctatgtc
ttccgcattatagcagaaaataagtttggtcagagtcagccttctgaaccaacagaccct
gttataaccaaagaagataagacaaaagtaattaattatgatgaagaagttgatgaggcc
agagaagtcaccacagcaaaggcagctcattcttctacaaaggaactctatgatagatat
atgattgctgaagaactcagccgtgggcaatttggaattgttcaccggtgcgttgagact
gcttccaagaagacttacctggctaagtttgtcaaagttaaaggtgctgatcaagtacta
gtaaagaaagaaatttctatcctaaacattgctagacacagaaatattatgtatcttcat
gaatcatttgaaagcttagaagagttgatcatgatctctgaattcatctctggagctgac
atctttgaaagattgaacactcctggttttgaacttaatgaaagagaaattgtaagctat
gtacgccaagtatgtgaagccctggaattcttacacagtcacagcattgcaaactttgat
atcaggcctgacaacattatttatttcacaagaagaagttctacaattaaacttattgaa
tttggccaggcaagacaactgaaacccggtgataatttcaggcttcagttcacttctcct
gaatattatggtcctgaagtccatcaacatgatctggttagcacagccacagatatgtgg
tcacttggaattctagtgtatgtacttctcagtggcctaaatcctttccttgctgaaaca
aaccaacagacagtagacaacatcatcagtgctgaatataattttgatgacgaagccttc
aaagatataagtattgaggccttggactttattgaccgcctactagtaaaagaaagaaaa
tctcgtatgactgctacagaagctcttaaccatccgtggttgaagcagagaaccgagaaa
accagcactaaagtaatcaaaacattaagacacagacgttactaccaaacactggtgaag
aaggaatggagtaccgttatatcaactgcccgtatttcatggggaggtgctgtcagatct
cagaagggagttactgttgctaaagttaaagtggcatcaattgatattggcccgctttct
agtcaaataatgcatgctgttggggaagaaggtggacatgtcaaatatgtctgcaaaatt
gaaaactatgactcggccacacaagtgaactggtattttggagtaaaacaactggaaaac
agtgaaaaatatgaaatcacctaccatgaaggcatagctacaatgtacgtcaaagatatt
gccaaagcagatgatggtacatatagatgcaaagttgtaaatgactatggggaagacagc
tcctatgcagaactatttgttaaaggtgtcagagaagtttctgactattacagatgcaga
actgtcaagaaagtgaagcgccgaatagataccatgcgacttttggagaagccaccagaa
tttaccttgcctctatataaccgaacagcctatgttggtgaaaatatccggtttggagta
actataacagttcacccagagcctcgtgtaacctggttcaaatcaggtcagaaaatcaaa
ccaggagatgatgataggaagtatacctttgaaacagataaaggtctttatcaacttcta
atccacaatgttaatgaggaggatgatgctgaatacactgtgttggcacgtaacaaatac
ggtgaggatagctgcaaagctaaactaacagttgttcatcatgctcctgccgaagctacc
actctgcgacccatgttcaaaaggctgttggcaaatgctgaatgtcaagaaagccagcat
gtctgctttgagataagagtctctggcattccaaaaccaacactgacatgggaaaaagat
ggtcagcctctctcagctagtcccaatattgaaattgtacatgaaggattagattattat
gctttacatataagggataccttgcctgaagacagtggctattacagagttactgctaca
aacagtgctggttctgcaagctgccaggcttacttgaaagtagaacgcttgagatatgtc
aagcgtgcatataagtctgaagaagagaagcaaaaagttgtacagaaaagaattgacaag
actgtgagaatggcagaaattctttccagaacagaatctgttccattgacacaagtagcc
caagaagctctgagagaagctgctattctatacaaaccagctgtaaccacaaaaactgtc
aaaggtgaatttgaactgaagaaggaagaaattaaagaagaaaaaagactccggatgcct
tacgagatcccagagccccgcaggcgcatggccactgctcttgaagaagatcagaacatc
aaattatttgtgcctatgtcagacatgaagtggtacaagaagctgagagaccagtatgaa
atgccaggaaaacttgacagaattgttcagaagcgacccaagcgcattcgtctctccaga
tgggaacaattctatgtgatgccactgccacgcatttcagatcaatataaacctaagtgg
cgcatacctaaattgtcacaagatgatcttgaaatagtgagaccagcacgtcgtcgtaca
ccatctcctgattatgacttttattataggccaagaaggcgatcccttggtgacttatct
gaagaagaactgcttctgcctgttgatgattacttggccatgaagagaactgaagaagaa
agattgcaacttgaagaagaattggagttaggcttttctgcttcacctccaagcagaagc
cctccacgctttgaactgtcctctcttcattactctgcagcagaagctcagagagctgca
gaactatctagaaaaagagagttgagatatgcaagctatcatataccctctaaagaagac
acgactgcaacttatgcacagcttcgacaacgtcatgacagggcagcttataggctatct
aaacaaaaggagagaataatggctgagaaagaagatgaagaactcctacgaccagttact
actagacagcggctctctgaatacaagagtgaactggaatatatgtcacaagaagaaaag
agacggttgagaagaaggagagaaaaagaaataactgagatcacatcaaaagaggaagaa
gaggaaatagaaatggtgaggcacgttcatcgggaatattcacctccttcaaggttactc
agaagaagacgttctctttctccaacttatattgagctgatgcgacctgtgtcagaatta
attcgacctcattcacatcctgtggaagaacctgagagaagatctcccacgccagaaaga
actcgtccacgttcaccaagtccagtatccagtgagagatctctctctagatttgaaagg
actgcaagatttgatatattttcaaggtatgagtccatgaaagctgctctgaaaactcaa
aaaacaatggaaaggaaatatgaagttctgactcaagaacccttcactctagatcatact
ccacgcatcactctgcgaatgcgctcacatcgtgtcccatgtggcaccaacaccagattt
attctgaatgttcagtccaagccaactgctgaggtgaaatggtatcataatggtattgaa
atccatgagagccataagatacattccactaacactagtggtgtattgaccttagagatc
cttgattgccatattgatgacagtggcacataccgtgttgtgtgcacaaactatagagga
gaatgtacggactatgcaacattagatgttacaggaggagattatactacctatagttcc
cagcgcagagatgatgaagttcctagaactgttattcctgatctgacaagaactgataca
tatgcaatctcttcatttaagaaaatttctgaaactgaagcaagctcttcggtaagagaa
gtcaagtcagaactgacagcaacaagggagtcattgtcatcatatgaacgtcatgcttct
gctgaaaagaaaatcagtgcgtcagagaaaaaatcaatagaagaaaaagctgtgcaccgg
aaatttaaaaccactctacctgctacaatattaacaaaaccccgctcgatcacagtttct
gaaggagagactgcaagattttcttgtgacaccgatggtgaaccaacaccaacagtgaca
tggctacgcggtggacaagttcttgcttcttccgggcgttatcatgtgacatgcactgaa
tataagtctacatttgaaatttcatctgttcagatctcagatgaaggcagctatactgtt
gtggtagaaaattctgaaggaaggcaggaagctcactttagtttaaccgttcaacaaaaa
cgggttccagaaaaagcagttacgtcacctccaagggtcaagtctcctgaacgtcatgtg
aaatctccagacagagtaaaatctccaaagcgagtaaagtctcctgaaccatctcctgcc
ccctccaaagcaaaatcaactgctgcagagaaaactgcaccggctgaaaaaacagacctg
ccagttgcaaaatcaactgctgcagagaaaaccccaccggctgaaaaaacagacctgcca
gttgcaaaaccaactgctgcagagaaaaccccaccggctgaaaaaacagacctgccagtt
gctgtcgctcccaagataacacaacaactgaaggttgatgtttctggtgataaagtaaaa
ctattctgctcagctgaaagcagtgtgttaagtgttcgagaagtatcctggtataaagat
ggcaagaaattaaaagaagatgatcgtttcaaacttcattatgcagctgatggaacttat
gaacttaacattcataaccttcaggactctgaccagggtgaatatacatgtgagattatc
ggagaagatggctcttctaaaactagctttcagtttactggacaagcattcaaaaatgcg
agtactcagatatcaagcttagccaaaacgcaaaagctggttcagaaagaagcagaagtc
cttgaattatctacccaaaagaaagctacagtgacttctcaagaaaaggcagtagtccaa
gaggaaattgttaagaagtctctaatatctgaagatattaagaagccttacccagaagtt
aaagctactaccagcaaaatgtcagtgtcggcaggccaaagaactgttctcaaagccaat
atttccaatgcttctgatgtaaaatggctgctaaatggagtagagttagctaactctgaa
gattatagatatggtgtatctggaagtgaccatacattgaccattagcaaggctactcag
aaagatgaaggaatgcttacctgtgaaggaaagacagaagatggtatcatcaaatgtcac
tttgaaatggaagtttccaaagatcttttaaatgccccaaccttcatcactcaaccaaga
tcccaaaatgttaatgaaggtcaaaatgtgctccttacctgtgaagtcactggagatcct
tctcctgagatccactggtttaaagataatcaaccaattgctctctcatccaacatccaa
gtgaatcgttcgaagaatatttattctcttgcaatccaaaatgctgcattgagcgatagt
ggaaaatacacagtcaaagcaaaaaattttcatgggcaatgctctgcaacagcatccttg
accgtcctttctctaattgaagaatctccaaaagaggtagtgttgagaagtggtgaagcg
agcatgcaggagagtttttcttcacagtcaattcaaatgtccgcttctaaacaagaagct
tcgttcagcagtagcagtatgactgaaatgaaatttgcaagcatgtcagccaaaagcatg
tcttccatgaaagaatcctttgtagagatgagctccagcagtgtaacggggaaatctagt
ctgacccaaatggacagttcaactagtagcttgcttaaatctggtatgagagggatacct
cccaaaatcgaagcgcttccaagtgatatctccatcgaggaaggaaaggtgctgaccatc
tcctgtgctttttctggagaacctgctcctgaaataacttggtcccgcagagggcaaaat
atttctagtcaggggggcagattccatattgaaacctgtgaagatttaaccacgtttatc
ataatggatgtccagaagaaggatgagggcctttacacgctgaatttagaaaatgacttt
ggcattgactctgccactgtgaacattaacattcgatcaatgtag

DBGET integrated database retrieval system