KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107290782Help
Entry
107290782         CDS       T05763                                 

Gene name
ACOX1
Definition
(RefSeq) peroxisomal acyl-coenzyme A oxidase 1 isoform X1
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur00071  Fatty acid degradation
pmur00410  beta-Alanine metabolism
pmur00592  alpha-Linolenic acid metabolism
pmur00640  Propanoate metabolism
pmur01040  Biosynthesis of unsaturated fatty acids
pmur01100  Metabolic pathways
pmur01200  Carbon metabolism
pmur01212  Fatty acid metabolism
pmur03320  PPAR signaling pathway
pmur04146  Peroxisome
Module
pmur_M00087  beta-Oxidation
pmur_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    107290782 (ACOX1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107290782 (ACOX1)
   00592 alpha-Linolenic acid metabolism
    107290782 (ACOX1)
   01040 Biosynthesis of unsaturated fatty acids
    107290782 (ACOX1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107290782 (ACOX1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107290782 (ACOX1)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    107290782 (ACOX1)
Enzymes [BR:pmur01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     107290782 (ACOX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_ox_N Acyl-CoA_dh_M Acyl-CoA_dh_1 Peptidase_C39
Motif
Other DBs
NCBI-GeneID: 107290782
NCBI-ProteinID: XP_015675183
Position
Unknown
AA seq 660 aa AA seqDB search
MNADLRKEREAASFKTELLTNFLDGGAEQTLRRKKIEAIVAKESFNHEDVNFLSRSQRYE
VAIKKSAFMVMKLRELGIADPEEIYWFKSCLHQGRPEPLDLHLGMFLPTLLTQATKEQQD
RFFMPAWNLEIIGTYAQTEMGHGTHLRGLETTATYDPATQEFILNSPTVTSIKWWPGGLG
KTSNYAIVLAQLYTQNKCHGLHAFIVPLRQLGTHEPLPGITVGDIGPKFGYDEMDNGYLK
MDNFRIPRENMLMKYAKVEPDGTYVKPLNAKLTYGTMVFIRSIIVGDAAHSLARACTIAI
RYSAVRHQSELKPGEPEPQILDYQTQQYKLFPLIATAYAFHFVGSYMRDTYHRITGNIQD
GDLSELPELHALSAGLKAFSSWTASAGIEECRMACGGHGYSRCSGLPDIYVNFTPSCTYE
GENTVMMLQTARFLLKSYTQVSSGQLVSGIMSYLNDLSGQHIQPQHVAARPTTLHINNPS
SFVEAYKLRASRMVEFAANNLQAELTRWKSKEDAWNRTSIDLVRASEAHCHYVVVKLFTE
KLSEIGDPDVHAVLNNLCLLYALCGIIKNSGDFLQGGILTEAQLIQVNMRIKELLALIRP
NAVALVDSFDFSDSMLGSVLGRYDGNVYENMFEWSKKSPLNKTQVHESFHKHLKPLQAKL
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcggatctgcggaaggagcgagaggcggcttctttcaagacggagctgctaacc
aacttcttggacgggggtgcagagcagaccctgcgccgcaagaaaatcgaagctattgtt
gcaaaggaaagcttcaaccatgaagatgtaaatttcctctctcgcagccagcgctatgaa
gtagctatcaaaaagagtgcttttatggtgatgaaattgagagaattaggaattgcagac
cctgaggagatctactggtttaaaagttgccttcatcaaggacggcctgagcctttggac
ctccacctgggcatgttcctgcccacattactaacccaggcaaccaaagaacagcaggat
cgcttcttcatgcctgcttggaacttggagatcattggcacatatgcccagacagagatg
ggacatggaacccatctccgaggactggaaaccacagccacctatgatcctgctacccag
gaattcatccttaacagtccaactgtgacttctattaagtggtggccaggtggattgggc
aagacatcaaactatgccattgttttggctcagctttatacgcaaaacaaatgtcatggg
ttacatgctttcattgtgcctctacgtcagttgggaacccatgaaccactaccaggtatc
accgttggtgacattggcccaaaatttggttatgatgaaatggataatggctacttaaaa
atggacaacttccgtatcccccgggaaaatatgctaatgaaatatgccaaggttgaaccc
gatggcacatatgtgaagcctctcaatgccaagctgacatatgggaccatggtattcatc
cgttcaattatcgttggagacgccgctcacagtttagccagagcttgtacaattgccatc
cgctatagtgctgtgagacatcagtctgagttaaagcctggggaaccagaacctcagatt
ttggattatcagacccagcagtacaaactctttcctctcatagcaacagcatatgctttc
cactttgtgggttcatatatgagagatacatatcatcgcatcactgggaacatccaggat
ggagacttgagtgaactgccagagttgcatgcactgtctgcagggctcaaggcgttcagt
tcctggactgccagcgctggcattgaggaatgtcggatggcatgtgggggacatggctac
tcccgctgcagtggtttgcctgatatttatgtcaacttcactccttcttgcacttatgaa
ggagagaacactgtgatgatgttgcaaactgcccgattccttctcaaaagttatacccaa
gttagttctggacaactagttagtggcatcatgtcttacctgaatgacctatcaggacag
catattcagccccagcatgtggctgctagacccacgactctgcatatcaacaatccttcc
agtttcgtggaggcatataaactgagagcttcaaggatggttgagtttgcagcaaataat
ttacaggctgaactgacccgttggaaaagcaaagaagatgcgtggaatcggacttcgatt
gatctagtacgagcatctgaggcacactgtcattatgtggtggtcaaactgtttacagag
aagctgtcagaaattggtgacccagatgtccatgctgtccttaacaatttgtgtttactg
tatgctctgtgtgggattataaagaactctggagactttctacagggaggcattttgacg
gaggcccagctaattcaagtgaacatgcgcataaaagaactcttggctcttatccgtcct
aatgcagtagctctggtggattcctttgatttttctgattctatgcttggatctgtgctt
ggccgatatgatggtaacgtatatgaaaatatgtttgaatggtcaaagaagtcaccacta
aataaaacacaggtccatgaatctttccacaaacacctgaagccattgcaagctaaactg
tga

DBGET integrated database retrieval system