KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107291671Help
Entry
107291671         CDS       T05763                                 

Definition
(RefSeq) succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur00020  Citrate cycle (TCA cycle)
pmur00640  Propanoate metabolism
pmur01100  Metabolic pathways
pmur01200  Carbon metabolism
Module
pmur_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pmur_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    107291671
   00640 Propanoate metabolism
    107291671
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pmur04147]
    107291671
Enzymes [BR:pmur01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     107291671
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     107291671
Exosome [BR:pmur04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107291671
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ligase_CoA ATP-grasp_2 Citrate_bind
Motif
Other DBs
NCBI-GeneID: 107291671
NCBI-ProteinID: XP_015676179
Position
Unknown
AA seq 212 aa AA seqDB search
AADQIKKLYNLFLQIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKTIFAMDDKS
ENEAMENEAAHYDLKYIGLDGNIACFVNGAGLAMATCDIISLNGGKPANFLDLGGGVKEA
QVYQAFKLLTADPKVEAILVNIFGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVHE
AQRILNESGLPITSASDLEDAAKKAVACVTKK
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
gcagcagatcaaataaagaagttatacaatcttttcctacaaattgatgccactcaagtg
gaagtgaatccctttggtgaaactccagaaggacaagtggtatgctttgacgccaagata
aattttgatgacaatgctgagttcaggcaaaaaaccatatttgccatggatgacaaatct
gagaatgaagcaatggaaaatgaagctgcccattacgacttaaagtatataggtctggat
ggaaacattgcctgttttgtaaatggcgctggacttgcaatggcaacctgtgatataatt
tcccttaatggtgggaaacctgccaactttctggatcttggcggaggtgtgaaagaagca
caagtgtatcaagcattcaaattgctcactgcagatcccaaggttgaagcaattttagta
aacatatttggtggaattgtcaattgtgccattattgccaacggtatcaccaaagcttgc
cgagagcttgaactgaaagtgcctctcgtggtccgacttgaaggaacaaatgttcacgaa
gcccagcgcattctgaatgaaagtggacttcccattacttctgcaagtgaccttgaagat
gctgctaagaaagcagtggcttgtgtgacaaagaaataa

DBGET integrated database retrieval system