KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107291722Help
Entry
107291722         CDS       T05763                                 

Gene name
FBP1
Definition
(RefSeq) fructose-1,6-bisphosphatase 1
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur00010  Glycolysis / Gluconeogenesis
pmur00030  Pentose phosphate pathway
pmur00051  Fructose and mannose metabolism
pmur01100  Metabolic pathways
pmur01200  Carbon metabolism
pmur04910  Insulin signaling pathway
Module
pmur_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107291722 (FBP1)
   00030 Pentose phosphate pathway
    107291722 (FBP1)
   00051 Fructose and mannose metabolism
    107291722 (FBP1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107291722 (FBP1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pmur04147]
    107291722 (FBP1)
Enzymes [BR:pmur01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     107291722 (FBP1)
Exosome [BR:pmur04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107291722 (FBP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FBPase Inositol_P
Motif
Other DBs
NCBI-GeneID: 107291722
NCBI-ProteinID: XP_015676237
Position
Unknown
AA seq 338 aa AA seqDB search
MTDRSTFDTNVTTVTRFVMEGGRKARGTGELTQLLNSLCTAVKAISTAVRKAGIANLYGI
SGSTNVTGDQVKKLDVLSNDMVINMLKSSFSTCIIVSEENKEAVIVEDDRQGKYIVCVDP
LDGSSNIDCLASIGTIFGIYRKVSPGAPCEKDALQPGRNMVAAGYALYGSATMLVLALES
GVNCFMLDPAIGEFILVNRDVKIKKKGNIYSLNEGYASYFDPAVTEYLQKKKFPQDGSSP
YGSRYVGSMVADVHRTLVYGGIFLYPANSKIPKGKLRLLYECNPMAFIIEKAGGAATTGK
EAILDIIPENIHERAPVVLGSSDDVEEYLAMVKKHSAK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgacagaccggtccaccttcgacaccaatgtgaccactgtgacccggttcgtgatggag
ggaggcaggaaagcgcggggcacgggagagctcactcagctgctcaactcgctctgcacg
gccgtcaaagctatctccaccgccgtgcgcaaggcgggcattgccaacctctatggaatt
tctggttctaccaatgtgacaggggaccaagtaaagaagttagacgttctttccaatgac
atggtgatcaacatgctgaaatcatcgttctcaacttgtatcattgtgtcagaagaaaac
aaagaagcagtaatagtggaagatgatagacagggtaaatatattgtctgcgttgatcca
cttgatggctcttctaatattgattgccttgcttctattggaaccatttttggcatctat
agaaaggtttcacctggtgctccttgtgaaaaggatgctctacagcctggtcgcaatatg
gtggcagccggttatgccctctatggaagtgctaccatgcttgtcctggccctggaatct
ggtgtcaactgttttatgcttgatccggcaatcggtgaattcattttggtcaatagggat
gttaaaataaagaaaaagggaaatatctacagtctaaatgagggatatgcatcgtacttt
gatccagcagtcacggaatatcttcagaagaagaaatttccccaagacggtagctctccc
tatggcagtaggtatgtaggttccatggtggctgatgtgcatcgtactttggtgtatgga
ggaatctttttatacccagccaattcaaagatccctaagggaaagctgagattgctctat
gaatgcaaccccatggctttcatcatcgaaaaagctggaggggctgcaacaacaggcaag
gaggcgatcttggacattattcctgaaaacattcatgaacgtgcgccagttgtgctgggc
tcttcagatgatgtggaggaatacttagccatggtcaagaagcattcagccaaatga

DBGET integrated database retrieval system