KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107291853Help
Entry
107291853         CDS       T05763                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase kinase 1-like
  KO
K00908  calcium/calmodulin-dependent protein kinase kinase 1 [EC:2.7.11.17]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pmur01001]
    107291853
Enzymes [BR:pmur01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     107291853
Protein kinases [BR:pmur01001]
 Serine/threonine kinases: Other
  CAMKK family
   107291853
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF1869
Motif
Other DBs
NCBI-GeneID: 107291853
NCBI-ProteinID: XP_015676372
Position
Unknown
AA seq 186 aa AA seqDB search
MGDSIAESVGQATDMGCKDAQMELAERVAAITVTASPNGIKPNSQEAIEETVVLLSNCTA
ENNQRNGVSVDSGTSEELDDTNELHEPKKVPKRPILTGRKYSLQEKSTGNYLSSSDLPDF
GPYATGPSTHISPRTGRRPTIESHRVSISDAADCVQLNQYKLKSEIGKGSYGVVKLAYNE
NDDQYY
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgggtgattctatagcagagtctgttggtcaagccacagacatgggttgcaaagatgct
cagatggagcttgccgagagagtagctgccatcactgtaacagctagtcccaatggaatt
aaaccaaatagtcaggaagcaatagaagaaactgttgttctgttatctaattgcacagct
gaaaacaaccaaaggaatggggtcagtgttgattcaggaacctctgaagaactggatgac
accaatgagctacatgagccaaagaaggtccccaaaaggcccattttgactggcaggaag
tattcccttcaagaaaagagtactgggaattacttgagttcctctgatcttccagacttt
ggtccatatgccacgggaccctccacacatatttcaccacgaacagggaggaggccaaca
atagagtcccaccgagtctctatctcggatgctgcggattgtgtgcagctgaatcaatac
aaactgaaaagtgaaataggaaagggttcttatggagttgtgaagctggcatacaatgaa
aatgatgatcaatattat

DBGET integrated database retrieval system