KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107292570Help
Entry
107292570         CDS       T05763                                 

Gene name
NUDT19
Definition
(RefSeq) LOW QUALITY PROTEIN: nucleoside diphosphate-linked moiety X motif 19
  KO
K13355  nucleoside diphosphate-linked moiety X motif 19, mitochondrial [EC:3.6.1.-]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107292570 (NUDT19)
Enzymes [BR:pmur01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     107292570 (NUDT19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NUDIX
Motif
Other DBs
NCBI-GeneID: 107292570
NCBI-ProteinID: XP_015677160
Position
Unknown
AA seq 415 aa AA seqDB search
MTSRPWREAATLLLARPERXAQSPVEPSRAEPSRRPCPAALRPPGMTSRPWREAATLLLA
VGGGRPRPSAAFDYQVLLLQRSARSAFLPSAQVFPGGVAEPADFSPAWRELLPKGPRCGL
GAEPPARPPLFTAGRPELGEASLPADVAFRICAIRETFEESGLLLLEPAAEQGASRADAP
ARLLPPAAGLEEWRRRVQGDPGSFLELCRHLGCAPHLRALHEWGNWLTPVDWSRPGGRRF
DTAFYLCCCPGQEPPAVSHDRQEVADCRWSTPLEAVERFNSGDIWVAPPQLYELYRLCRF
SSLHNLERFSSGRALEGCERWMSVHLTASDGRIHLLPGDDLYPKDPDFTGERKSVLTTNK
NIEELMKEVKNLHRIVIRSLTNVTIHMNIESKYKHINPVTVASKMXNNADCNSQL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgcggccctggcgggaggcggccacgctgctcctggcgcgcccggagcgcngc
gcgcagagcccggtcgagccgagccgagccgagccgagccgccgcccttgccccgcggcc
cttcgccctcccggcatgacctcgcggccctggcgggaggcggccacgctgctcctggcg
gtgggcggcggacggcctcggccctcggccgccttcgactaccaggtgctgctgctgcaa
cgcagcgcccggagcgccttcctacccagcgcgcaggtcttcccgggcggcgtggcggag
cccgccgacttctctcccgcctggcgggagctgctgcccaagggcccgcgttgcgggctg
ggcgccgagccccccgcccggccgcccctcttcaccgccggccggcccgagctgggcgaa
gcttcgctgccggccgacgtggccttccgcatctgcgccatccgggagaccttcgaggag
agcgggctgctgctgctggagcccgccgccgagcagggcgcctcccgggcggacgcgccg
gctcgcctgctgcccccggccgccgggctggaggagtggcggcggcgggtgcagggcgac
ccgggcagcttcctggagctctgccgccacctgggctgcgcgccccacctgcgggcgctg
cacgagtggggcaactggctgacgcccgtggactggagcaggcccggcgggcgccgcttc
gacaccgccttctacctgtgctgctgccccgggcaggagccgcccgccgtctcgcacgac
cggcaggaggtggcggactgcaggtggtcaacccctttagaagctgttgaacgttttaac
tctggagacatctgggtagcaccacctcagctttatgagttatataggctctgccgtttt
tcatcccttcataatctggagaggtttagttcaggacgagctttagaaggttgtgaacgc
tggatgtcagttcacttgacggcttcagatggccgcatacatttgttgccaggtgacgat
ttatatccaaaagatcccgattttactggcgaaaggaaatctgtgttgacaacaaataaa
aacattgaagaactaatgaaagaggtcaaaaaccttcaccggatagtgatacgaagcctt
actaatgtaactatccacatgaatattgaatccaaatataaacatataaatccagttaca
gtggcctctaaaatgtgaaataatgcggattgcaacagtcagttgtag

DBGET integrated database retrieval system