KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107292936Help
Entry
107292936         CDS       T05763                                 

Gene name
NDUFS3
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
  KO
K03936  NADH dehydrogenase (ubiquinone) Fe-S protein 3 [EC:7.1.1.2 1.6.99.3]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur00190  Oxidative phosphorylation
pmur01100  Metabolic pathways
Module
pmur_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    107292936 (NDUFS3)
Enzymes [BR:pmur01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     107292936 (NDUFS3)
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     107292936 (NDUFS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Complex1_30kDa
Motif
Other DBs
NCBI-GeneID: 107292936
NCBI-ProteinID: XP_015677550
Position
Unknown
AA seq 258 aa AA seqDB search
MLAAVRGLARVGLRAAGRPAVLLQTRFEGNYSAETKPTIRPKDEIAQKQLSAFGEYVAEI
LPKYVQQVQITCFNELEILIHPDGILPVIAFLKDHTNAQFKNIVDLTAVDIPNRQYRFEI
VYNFLSLHYNSRIRVKTYTDELTPIESLVPLFEGANWYEREVWDMFGVFFANHPDLRRIL
TDYGFEGHPFRKDFPLSGYVEVRYDDEVKRVVAEPLELAQEFRKFDLNSPWETFPAYRQA
PQTLKIEPGEKKGDGKQQ
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgcttgcggcagttcgagggctagcccgagtcgggctaagagctgctgggcgtcctgca
gtgctattacagactcggtttgaaggaaattattctgctgaaactaagcccacaattaga
ccaaaggatgaaatagctcagaaacagctgtccgcctttggagaatatgttgctgagatt
ctgcctaaatatgttcaacaagtccagataacatgtttcaatgagctggaaattttaatt
catccagatggaatccttcctgtgatagcttttctgaaagatcacacaaatgcccagttc
aaaaacatagttgacctgacagcagtcgatattccaaatcggcaataccgtttcgaaatt
gtctataatttcttatctctacactataattcccgaattcgtgtgaaaacatatactgac
gaattgacaccgattgagtctctagtaccattatttgaaggggcgaattggtatgaaaga
gaggtctgggatatgtttggagtattttttgccaaccacccagatctgaggcgaatcctt
acagattatggttttgaaggtcatcctttcaggaaagatttccccctttctggatatgtg
gaggtcagatatgatgatgaggtgaagcgagtggtcgcagagccgttggaattggctcaa
gagttccgcaaatttgatctgaacagtccttgggagactttccctgcctatcgccaggct
ccccaaaccttgaagatagaaccaggagagaagaaaggagatgggaaacaacagtga

DBGET integrated database retrieval system