KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107292936
Entry
107292936         CDS       T05763                                 

Gene name
NDUFS3
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
  KO
K03936  NADH dehydrogenase (ubiquinone) Fe-S protein 3 [EC:7.1.1.2]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur00190  Oxidative phosphorylation
pmur01100  Metabolic pathways
Module
pmur_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    107292936 (NDUFS3)
Enzymes [BR:pmur01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     107292936 (NDUFS3)
SSDB
Motif
Pfam: Complex1_30kDa
Other DBs
NCBI-GeneID: 107292936
NCBI-ProteinID: XP_015677550
Position
Unknown
AA seq 258 aa
MLAAVRGLARVGLRAAGRPAVLLQTRFEGNYSAETKPTIRPKDEIAQKQLSAFGEYVAEI
LPKYVQQVQITCFNELEILIHPDGILPVIAFLKDHTNAQFKNIVDLTAVDIPNRQYRFEI
VYNFLSLHYNSRIRVKTYTDELTPIESLVPLFEGANWYEREVWDMFGVFFANHPDLRRIL
TDYGFEGHPFRKDFPLSGYVEVRYDDEVKRVVAEPLELAQEFRKFDLNSPWETFPAYRQA
PQTLKIEPGEKKGDGKQQ
NT seq 777 nt   +upstreamnt  +downstreamnt
atgcttgcggcagttcgagggctagcccgagtcgggctaagagctgctgggcgtcctgca
gtgctattacagactcggtttgaaggaaattattctgctgaaactaagcccacaattaga
ccaaaggatgaaatagctcagaaacagctgtccgcctttggagaatatgttgctgagatt
ctgcctaaatatgttcaacaagtccagataacatgtttcaatgagctggaaattttaatt
catccagatggaatccttcctgtgatagcttttctgaaagatcacacaaatgcccagttc
aaaaacatagttgacctgacagcagtcgatattccaaatcggcaataccgtttcgaaatt
gtctataatttcttatctctacactataattcccgaattcgtgtgaaaacatatactgac
gaattgacaccgattgagtctctagtaccattatttgaaggggcgaattggtatgaaaga
gaggtctgggatatgtttggagtattttttgccaaccacccagatctgaggcgaatcctt
acagattatggttttgaaggtcatcctttcaggaaagatttccccctttctggatatgtg
gaggtcagatatgatgatgaggtgaagcgagtggtcgcagagccgttggaattggctcaa
gagttccgcaaatttgatctgaacagtccttgggagactttccctgcctatcgccaggct
ccccaaaccttgaagatagaaccaggagagaagaaaggagatgggaaacaacagtga

DBGET integrated database retrieval system