KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107293065Help
Entry
107293065         CDS       T05763                                 

Definition
(RefSeq) voltage-dependent T-type calcium channel subunit alpha-1I-like
  KO
K04856  voltage-dependent calcium channel T type alpha-1I
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur04010  MAPK signaling pathway
pmur04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107293065
   04020 Calcium signaling pathway
    107293065
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pmur04040]
    107293065
Ion channels [BR:pmur04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107293065
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PKD_channel TMEM208_SND2
Motif
Other DBs
NCBI-GeneID: 107293065
NCBI-ProteinID: XP_015677684
Position
Unknown
AA seq 886 aa AA seqDB search
MAANYKWVHHKYNFDNLGQALMSLFVLASKDGWVNIMYNGLDAVAVDQQPVTNNNPWMLL
YFISFLLIVSFFVLNMFVGVVVENFHKCRQHQEAEEARRREEKRLRRLEKKRRKAQRLPY
YATYCPVRLLIHSVCTSHYLDIFITFIICLNVVTMSLEHYNQPVSLETALKYCNYMFTTV
FVLEAVLKLVAFGLRRFFKDRWNQLDLAIVLLSVMGITLEEIEINAALPINPTIIRIMRV
LRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGKLVCNDE
NPCEGMSRHATFENFGMAFLTLFQVSTGDNWNGIMKDTLRDCTHDDRSCLSNLQFISPLY
FVSFVLTAQFVLINVVVAVLMKHLDDSNKEAQEDAEMDAEIELEMAHGLCPHSTSSLNPG
QDGGGGKKDSEGHLCMTCYSPAQENLWLDSVSLIIKDSFDGELMIIDNLSGSVFHHYSSP
AMCEKCNHDKQEIQLAEMEALSLNSDKSSILLGDDGDISNIDQPSPKEKDGEDSPNSTRN
TGLEECLFPLTNTGSSLPPENYQYEMEKISFSRAQSWLNNETNEGSPLVFSCPDAPHSLL
PVQTEFFLPVVSAKLSNQEKISCPENLPKISLQASWASLQSPNVNSSLIHQTTESDTSLD
DGRSNSSDGSLQTTLEDSLNLSDSPQCTLDLPVVLCPVPAATQKALVVPLSPVSRRQSIR
GRGIFTLQNIRRHQRSHSSGGSTSPGCTYHDSMDPSDEEGIGSNLRGGGNSSEQSETLSS
FSLTSLFSPPPPSQALALVKKCNSTSSLHANSSSRSSAANEAKQFYSVDPRGFLSMPSWV
TDFCKNSPSPREGDVPEGLDKIGTPDHSPPVPSELQLGTRVSKRHR
NT seq 2661 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaattacaaatgggtacatcacaaatacaactttgataatctgggccaggct
ttgatgtcgctctttgttctggcttccaaagatggctgggttaatattatgtacaatgga
ctagatgctgtggctgtggatcaacagccagtgaccaacaacaacccttggatgctactt
tacttcatttctttcttactcatcgtcagcttcttcgtgctcaacatgtttgtaggggtg
gtggtggagaattttcacaagtgtcggcaacaccaagaagccgaagaggcccggaggcgg
gaagaaaagcgtttgaggcgcctggagaagaagcgtaggaaagcacagcgcttgccgtac
tatgctacctactgccctgtccgcctcctcatccattcagtctgcaccagccactacttg
gacatctttatcacctttataatctgcctcaacgttgtcaccatgtctttggagcactac
aaccaaccagtgtccctggaaactgctcttaagtattgcaactacatgtttactacagtc
tttgttttggaagcagttttgaagcttgtggcctttggactgagacgcttttttaaagac
aggtggaaccagctggatctagctattgttctgctctcagtcatgggaattactctggaa
gagattgaaatcaatgctgcccttccaatcaatcccaccattatccgcatcatgagagtg
cttcgtattgcccgagttttgaaacttttgaagatggcaactgggatgagagctttattg
gacactgtagtacaagctctgccacaggttgggaatcttggactcctcttcatgctcctt
tttttcatttatgctgctctaggagtagagctttttggcaaacttgtctgcaatgatgaa
aacccatgtgaaggaatgagccgccatgccacctttgagaattttggaatggccttcctc
acacttttccaggtctccactggtgacaactggaatggcattatgaaggatacactacgt
gactgcactcatgatgaccggagctgcctgagcaaccttcagttcatctctccactctac
tttgttagcttcgtgctcacagcccaatttgtcctcatcaatgttgtagtagctgtcctt
atgaagcacctagatgacagcaacaaggaagcacaggaggatgcagaaatggatgctgag
attgagcttgagatggcacatggattgtgccctcatagcactagctcactgaatcctgga
caagatggaggaggtgggaaaaaggactctgaaggacatctatgcatgacatgttactct
ccagcacaggagaacttatggctggacagtgtgtctttaataattaaagactccttcgac
ggggagttaatgatcatcgataacctatcgggctccgtcttccatcattactcctcgccg
gccatgtgcgagaagtgtaaccatgacaagcaagagatccagctggctgaaatggaggcc
ttatcactcaattctgataagtcttctatcctgctaggagatgatggagatatttccaac
attgaccagccaagccctaaggaaaaggatggtgaagacagccctaattctacaaggaat
acaggcttggaagaatgtctcttccctttaacaaatacaggatcttctctgcctccagaa
aactaccagtatgaaatggaaaaaatctctttcagtcgagctcagtcttggctaaataat
gagaccaacgaaggtagcccccttgttttctcctgtccagatgcaccccattctctattg
ccagttcaaacagagttttttctccccgttgtttctgctaaactatcaaatcaggagaaa
atatcttgtccagagaaccttcctaaaatctctctgcaagcttcctgggcctcactgcaa
tctccaaatgtaaactcctcgcttattcaccagaccacagagagtgacacttcccttgat
gatggcaggagcaatagctcagacggcagcttgcagaccacactggaagacagtttaaac
cttagtgactcaccccagtgcaccctggatctcccagtagtattatgcccagtgccagca
gccactcaaaaagctttggtggtcccactttcccctgtctctcgaaggcaaagcataagg
ggacgtggcatcttcactctccagaacatcaggaggcaccagcggagccacagcagtgga
ggaagcactagcccaggttgtacttatcatgattccatggacccttctgatgaagaaggg
atagggagcaacttaaggggaggaggtaacagcagtgagcagtcagagaccctcagcagt
ttttctctgacttctctcttttcacctcctcctccatctcaagctctggcacttgtgaag
aagtgcaacagcaccagcagtctccatgccaactcttcttcacggagttctgcagcaaat
gaagccaagcagttctactcagttgacccaaggggttttttatctatgccatcttgggtg
acagacttctgcaagaacagcccttctccaagagagggtgatgtaccagagggcttagac
aaaattgggactccagaccacagccccccagttccttctgagctgcagctggggaccaga
gtcagcaagagacatagatga

DBGET integrated database retrieval system